(data stored in ACNUC1104 zone)

EMBL: CP001966.PE463

CP001966.PE463       Location/Qualifiers
FT   CDS_pept        complement(501792..502688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0476"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mav:MAV_4120
FT                   hydrolase, alpha/beta fold family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77117"
FT                   /db_xref="GOA:D5US50"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5US50"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77117.1"
FT                   /translation="MTDQTRFDVPTSDGLTLAGFRYGEHDPALPTVLAIHGYPDNHHVW
FT                   DGVAAALAGRANVYTYDVRGAGDSEAPAGKAGYRFDRLISDVSKVIDAVREQSGDRSKV
FT                   HLLGHDWGSIQGWHAVVDPAVADKTASYTSISGPNLNHAGEYLKGARRFADVPARLRQA
FT                   AGSTYIPFFLAPGLADALYRRGWGQKLIETLEKRGTGGRTAEGYERSDRDFTNGLNLYR
FT                   ANMPGPFLKPAAADTTVPVQVVTPEGDLFVTRPVQLAGLTHSPKSRDVSVPGGHWVVAQ
FT                   NPSPVADVTFEWIEANR"
     atgactgatc agacccgctt cgacgtgccc acctcggatg ggctcacgct cgccggattc        60
     cgttacgggg agcacgatcc cgcgttgccc acggtgctgg cgatccacgg ctaccccgac       120
     aatcaccacg tctgggacgg cgttgcggcg gccttggccg ggcgcgccaa cgtgtacacc       180
     tacgacgtcc gcggcgcggg cgactccgag gcgcccgcgg gcaaggcggg ctaccgcttc       240
     gaccggctca tctccgacgt ctccaaggtg atcgacgccg tgcgcgagca atccggcgac       300
     cggtcgaagg tgcacctgct gggccacgac tggggctcga tccagggctg gcacgcggtg       360
     gtcgaccccg ccgtggccga taagacggcg agctacacct cgatctccgg ccccaacctg       420
     aaccatgcgg gcgaatatct caaaggtgca cggcgattcg cggacgtgcc cgcgcggctg       480
     cgccaggcgg cgggctccac ctacatcccg ttcttcctcg cccccggact ggcagatgcg       540
     ctctaccgcc gcggctgggg ccagaaattg atcgagacgc tggagaagcg cggcaccggc       600
     gggcgcaccg cggagggcta cgagcgctcg gaccgcgatt tcaccaatgg gttgaacctg       660
     taccgggcca acatgcccgg gcctttcctc aagcccgccg ccgcggacac caccgtgcca       720
     gtgcaggtgg tcacgcccga gggcgatctc ttcgtcaccc gcccggtgca gctggccggc       780
     ctcacacact ccccgaagtc gcgcgatgtc tcggtgcccg gcggacactg ggtggtggca       840
     cagaaccctt ctcccgtcgc cgatgtgacc ttcgagtgga tcgaggcgaa ccgatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page