(data stored in ACNUC1104 zone)

EMBL: CP001966.PE464

CP001966.PE464       Location/Qualifiers
FT   CDS_pept        complement(502698..503855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0477"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: msm:MSMEG_3676 phenoxybenzoate dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77118"
FT                   /db_xref="GOA:D5US51"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5US51"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADG77118.1"
FT                   /translation="MTGAGIDPTKGRKSPSVFRPWGEPVTEVPPHLYGRWKRDPLLRFA
FT                   NAFFSTTIPAFAHLMKPRDLAEPDTSRQLRVIGREIVAHDKDVVALTLESADGTPLPRW
FT                   TPGAHLDLLLPSGRMREYSLCGDPADADTYRIAVRRIPTGGGGSVEVHETLHLGSTVTV
FT                   KGPRNGMPMAVPGHGSAAQHLRFVAGGIGITPILPMMIAAERLGLDWSMLYTGRSTDTI
FT                   PFISEVAKFGDKVEIRTDDVHGIPTADVLIGDTPGPTALYSCGPIPMLEALRIGLIGRT
FT                   DVELHYERFSAPPVVDGKPFTATLSETGTTVDVGAEETLLAAVLKARPDAPYSCRQGFC
FT                   GTCRVTVTEGTVDHRDQTLTPYEREQGQMLTCVSRAAGDHLTIDL"
     atgaccggcg ccggcatcga tccgacgaag ggccgcaagt ccccgtcggt cttccgaccc        60
     tggggtgagc ccgtcaccga agttcctccc catctctacg gccgatggaa gcgggatccc       120
     ctcctgcgct tcgccaatgc gttcttcagc accaccatcc ccgcgttcgc gcacctgatg       180
     aagccgcgcg atctcgccga gcccgacacc tcgcgccagt tgcgggtgat cggccgcgag       240
     atcgtcgcgc acgataagga cgtcgtcgcg ctcacgctgg aatcggccga cggtacgcct       300
     ctgccccgct ggacgccggg agcacacctc gacctcctgc tcccttccgg ccgcatgcgc       360
     gagtactcgc tgtgcggcga tcccgcggac gccgacacgt accggatcgc ggtgcgccgc       420
     ataccgaccg gtggcggcgg ctcggtggag gtgcacgaga cgctgcacct cggttccacg       480
     gtcaccgtca aggggccgcg caacggcatg ccgatggccg tgcccggtca cggctccgcg       540
     gcgcagcatc tgcgattcgt ggccggcggc atcggcatca cgcccatcct tccgatgatg       600
     atcgccgccg agcggctcgg tctcgactgg tcgatgctgt acaccggccg atcgaccgac       660
     accatcccgt tcatcagcga ggtggcgaag ttcggcgaca aggtggagat ccgcaccgac       720
     gatgtgcacg ggatccccac cgccgatgtc ctgatcggcg acacccctgg acccaccgcg       780
     ctgtactcgt gcggcccgat ccccatgctc gaggcgctgc gcatcgggct gatcggccgc       840
     accgatgtgg agctgcatta cgagcgcttc tcggctccgc ccgtggtcga tgggaagcct       900
     ttcaccgcaa cactgtccga gaccggcacc accgtcgatg tgggagccga ggagacgctg       960
     ctcgcagcgg tgctcaaggc ccggcccgat gccccgtact cgtgccgtca ggggttctgt      1020
     ggaacctgcc gggtgacggt gaccgaaggc accgtcgacc accgggacca gaccttgaca      1080
     ccgtacgagc gggaacaggg gcagatgctc acctgcgtct cccgcgccgc cggcgatcac      1140
     ctcaccatcg acctctag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page