(data stored in ACNUC1104 zone)

EMBL: CP001966.PE465

CP001966.PE465       Location/Qualifiers
FT   CDS_pept        complement(503852..504748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0478"
FT                   /product="Uncharacterized conserved protein UCP07580"
FT                   /note="PFAM: Uncharacterised conserved protein UCP07580;
FT                   KEGG: mjl:Mjls_2904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77119"
FT                   /db_xref="GOA:D5US52"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:D5US52"
FT                   /inference="protein motif:PFAM:PF10118"
FT                   /protein_id="ADG77119.1"
FT                   /translation="MSSRATAHEHEPAEVEIHARNVTFDWENTPLEWIPGEPVASDIIS
FT                   SILHSVLPEGERWFCEVYNEALPYVKDENLARTMRGFIGQEAMHAESHDRALSEYLARC
FT                   GIDTTPVARQFEYIFRKILAPRTYRSDRAQYNDMVQRLWLIAAVEHYTAILGVFALNND
FT                   WDKYGVDPTMADICRWHGAEEVEHRSVAHDVANYFDPSYFHRCRAMIVGVVFLVLALHR
FT                   TSGYMLRKDPNFSYSYPRLWWEYLRGSRKNILPKLRDVIKFTLIYFKPSFDPASIGSTA
FT                   QAVAYLATSPAARAANG"
     atgagctccc gagcaacggc gcacgagcac gagcccgccg aggtcgagat ccacgcccgg        60
     aacgtcacct tcgactggga gaacaccccg ctcgaatgga tccccggcga gcccgtggcc       120
     agcgacatca tcagcagcat cctgcactcc gtgctccccg agggcgagcg gtggttctgc       180
     gaggtctaca acgaggcgct cccgtacgtg aaggacgaga acctcgcccg caccatgcgc       240
     ggcttcatcg gccaggaggc catgcacgcc gagtcgcacg accgcgcgct cagcgaatac       300
     ctcgcgcgct gcggcatcga caccacgccc gtggcccggc agttcgagta catcttccgc       360
     aagatcctcg cgccgcgcac ttaccgctcg gaccgcgccc agtacaacga catggtgcag       420
     cgcctgtggc tgatcgcggc cgtcgagcac tacaccgcca tcctcggagt gttcgcgctc       480
     aacaacgact gggacaagta cggcgtcgat cccacgatgg ccgacatctg tcgctggcac       540
     ggcgcagagg aggtcgagca ccgcagcgtc gcgcacgatg tggcgaacta cttcgacccc       600
     agctacttcc accgctgccg cgccatgatc gtgggcgtgg tgttcctggt actcgcgctg       660
     caccgcacgt cgggttacat gctccgcaag gatccgaact tcagctactc gtacccgcga       720
     ctgtggtggg agtacctcag gggctcgcgc aagaacatcc ttcccaagct ccgcgacgtc       780
     atcaagttca cgctgatcta cttcaagccc agcttcgacc ccgcctcgat cggctcgacg       840
     gcgcaggccg tggcctacct cgccacgtcg ccggcggccc gggcggcgaa cggatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page