(data stored in ACNUC1104 zone)

EMBL: CP001966.PE467

CP001966.PE467       Location/Qualifiers
FT   CDS_pept        505254..505730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0480"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bcv:Bcav_2882 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77121"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5US54"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADG77121.1"
FT                   /translation="MPVLSTTSDREALTFDLVAEFATSPERVWQLWEDPRLLEKWWGPP
FT                   TWPATFVRHELTPGGQSRYYMTGPDGTKAGGWWETVATDAPSTFVFRDGFAGEDGEPVD
FT                   PEDYSTNTVVLTRTGDVTRMNLTAAHRSLEQLDRVLEMGMTEAMNQIDALLAAV"
     atgcccgttc tgtccaccac gagtgatcgt gaggcgctga ccttcgacct ggtcgccgag        60
     ttcgccacct ccccggagcg ggtgtggcag ctgtgggagg acccgcgcct attggagaag       120
     tggtggggcc cgcccacctg gccggccaca ttcgtccgcc acgaactcac accgggcggc       180
     cagtctcggt actacatgac cggcccggac ggcacgaagg ccggaggctg gtgggagacg       240
     gtcgcgaccg acgccccgtc gaccttcgta ttccgggacg gcttcgcggg ggaggacggc       300
     gagcccgtcg atcccgagga ctactccacg aacacggtcg tgctcacccg gacgggcgat       360
     gtcacgcgga tgaacctcac tgcggcccac cggtcactcg aacagctgga tcgcgtgttg       420
     gagatgggga tgaccgaggc gatgaaccag atcgacgccc tgctcgccgc tgtctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page