(data stored in ACNUC1104 zone)

EMBL: CP001966.PE469

CP001966.PE469       Location/Qualifiers
FT   CDS_pept        506585..507997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0482"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: rop:ROP_04910
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77123"
FT                   /db_xref="GOA:D5US56"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR024026"
FT                   /db_xref="InterPro:IPR024740"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038546"
FT                   /db_xref="UniProtKB/TrEMBL:D5US56"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG77123.1"
FT                   /translation="MQTDRVYLTISTTYAPATELGYLLHKHPDRVQEFRQPFGVATVFY
FT                   PEAGPDRCTAALLLEVDPIQLAKRRRASPDFSLGQYVNDRPYAASSLLAAALADVFRSA
FT                   RHGRAGSRQELADTAIPLQIEIPVLPCRGGAEVAERVFAPLGWDVDATPIELDGGFPEW
FT                   GQSRYVRLRLTGRMRLAEAINHLYVLLPVLDESKHYWQGPDEVDKLLRSGEGWLASHPD
FT                   RELITRRYLGRGPGLAAEALDRLAALDDAGPAAAEVDEAVDIAPAKPLNALRHDAVHRV
FT                   IVESGASTVIDLGCGPGQFVERLLATRGIERVAGCDVSTRSLQRAAQRLHLDDMTERQR
FT                   ERIDLFQAALTYEDERLSGYDAAVLMEVIEHVDPSRLGALEHVVFGGARPGTVIVTTPN
FT                   SEYNVLYPDLVGMRHTDHRFEWDRTEFIRWSTAIAERYGYAVRHEGIGEADPDRGTPTQ
FT                   MAIFTRKESADA"
     gtgcagactg accgggtgta cctgaccatc tcgaccacgt atgcgcccgc gaccgaactg        60
     gggtatctcc tgcacaagca tcccgaccgg gtgcaggagt tccgccagcc cttcggcgtg       120
     gccaccgtgt tctacccgga ggccggcccg gaccggtgca cggccgcgct gctgctcgag       180
     gtcgatccga tccagctggc caagcggcgc cgcgccagtc ccgatttctc cctcgggcag       240
     tacgtcaacg accggccgta cgccgcatcc tcactgctcg ccgcggctct cgccgatgtc       300
     ttccgcagcg cgcgacacgg gcgggccgga agccgacagg agctggcgga cacagcgatt       360
     ccgctgcaga tcgagattcc ggtgctgccc tgccgcggtg gcgccgaggt cgctgagcgg       420
     gtattcgccc cgctcggctg ggatgtcgac gcgacaccga tcgagctcga cgggggcttc       480
     cccgagtggg gccagtcgcg gtacgtgcgg ttgcgcctca ccggcaggat gcgcctggcg       540
     gaggcgatca atcacctgta cgtgctgctc ccggtgctcg atgagtccaa gcactactgg       600
     cagggacccg acgaggtcga caagttgctc cgctccggcg agggctggct ggcatcccat       660
     ccggaccgcg agctgatcac ccgccggtac ctcggccgag ggcccggact cgccgccgag       720
     gcgctcgacc ggctcgccgc gctcgacgac gccggccccg ccgcggccga ggtcgacgag       780
     gccgttgaca tcgctccggc taagccgctc aacgcacttc ggcacgatgc ggtgcaccgg       840
     gtgatcgtcg agagcggggc gagcacggtg atcgatctcg gctgcgggcc cggccagttc       900
     gtcgagcggc tgctcgccac ccgcggcatc gaacgggtcg cgggctgcga tgtctccacc       960
     cgatcgttgc agcgcgccgc ccagcgcctg catctcgacg acatgacgga gcggcagcgc      1020
     gagcgcatcg acctgttcca ggccgcgctc acgtacgagg acgagcgact gtcgggatac      1080
     gacgccgccg tgctgatgga ggtcatcgag cacgtcgacc cgtcgcggct cggcgcgctc      1140
     gaacacgtgg tcttcggtgg tgctcgcccc ggcaccgtca tcgtcaccac gcccaacagt      1200
     gagtacaacg tgctctaccc ggatctcgtg gggatgcggc acaccgatca tcggttcgag      1260
     tgggaccgca ccgagttcat ccgatggtcc accgcaatag ccgaacggta cggctacgcc      1320
     gtgcggcacg aggggatcgg tgaagccgat cccgaccggg gaacccccac ccagatggcg      1380
     atcttcacga ggaaggagtc cgccgatgcc tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page