(data stored in ACNUC1104 zone)

EMBL: CP001966.PE473

CP001966.PE473       Location/Qualifiers
FT   CDS_pept        514723..516564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0486"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: nfa:nfa54090 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77127"
FT                   /db_xref="GOA:D5US60"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D5US60"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADG77127.1"
FT                   /translation="MGRAVGIDLGTTNSCVAVLEGGDPVVIANAEGSRTTPSVVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTIRSVKRHIGTDWSQKIDDKDYTSQEISARTLMKLKRDAE
FT                   AYLGEDVTDAVVTVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGDGVVEVRATSGDNNLGGDDWDQRIVDWLVEKFKAQHGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSGQSTSINLPYITVDADKNPLFLDENLSRSEFQKI
FT                   TSDLLERTRSPFQAVIKDAGISVGDIDHVVLVGGSTRMPAVTDLVKELTGGQEPNKGVN
FT                   PDEVVAVGAALQAGVLRGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVFQGEREIAAHNKLLGSFELTGIAPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIKISDGSGLSQEEIDRMIKDAEAHASEDKARREEAETRNQAESLV
FT                   NQTEKFLSENADKVPAENKEKVEAAIKEANEALQGTDIAAVKAAVEKLSTESQALGQAL
FT                   YAQAGAEAQAEGAEQAAQADDGVVDAEVVDEDPKDAK"
     atgggacgtg cagtaggcat cgacctcggc accaccaact cgtgcgtcgc agtcctcgag        60
     ggcggcgacc cggtcgtgat cgctaatgcc gagggctcgc ggaccacccc gtcggtggtc       120
     gccttcgcac gcaacggcga ggtcctggtg ggccagcccg ccaagaacca ggccgtcacc       180
     aacgtcgacc gcaccatccg ctcggtcaag cgccacatcg gcaccgactg gtcgcagaag       240
     atcgacgaca aggattacac cagccaggag atcagcgctc gcacgctgat gaagctcaag       300
     cgcgacgccg aggcctacct cggtgaggac gtgaccgacg ccgtcgtcac cgtccccgcg       360
     tacttcaacg acgcgcagcg ccaggccacc aaggaagccg gccagatcgc cggcctcaac       420
     gtgctccgca tcgtcaacga gccgaccgcc gccgctctgg cgtacggcct cgacaagggc       480
     gagaaggagc agaccatcct ggtcttcgac ctcggtggcg gtaccttcga cgtctcgctg       540
     ctggagatcg gcgacggtgt cgtcgaggtc cgcgcgacct cgggcgacaa caacctcggt       600
     ggtgacgact gggatcagcg catcgtcgac tggctcgtcg agaagttcaa ggcgcagcac       660
     ggcatcgacc tgaccaagga caagatggcc atgcagcgtc tgcgtgaggc cgcggagaag       720
     gcgaagatcg agctgagctc gggtcagagc acgtcgatca acctgccgta catcacggtg       780
     gacgccgaca agaacccgct gttcctcgac gagaacctca gccgcagcga gttccagaag       840
     atcaccagtg atctgctgga gcgcacccgc agccccttcc aggccgtgat caaggacgcc       900
     gggatctccg tgggcgatat cgaccacgtg gtgctcgtgg gtggttccac ccgtatgccc       960
     gccgtgaccg acctggtcaa ggagctcacc ggtggtcagg agcccaacaa gggcgtgaac      1020
     cccgacgagg tcgtcgccgt gggcgccgcc ctgcaggccg gcgtgctgcg cggcgaggtc      1080
     aaggacgtgc tgctgctcga tgtgaccccg ctgagcctgg gcatcgagac caagggcggc      1140
     gtgatgacca agctcatcga gcgcaacacc accatcccca ccaagcggtc cgagaccttc      1200
     accacggccg acgacaacca gccgtcggtg cagatccagg tcttccaggg cgagcgtgag      1260
     atcgccgcgc acaacaagct gctcggcagc ttcgagctga ccggcatcgc gccggccccg      1320
     cgcggcgtgc cccagatcga ggtcaccttc gacatcgatg ccaacggcat cgtgcacgtg      1380
     accgcgaagg acaagggcac cggcaaggag aacacgatca agatctccga cggcagtggt      1440
     ctgtcgcagg aggagatcga ccggatgatc aaggacgccg aggcgcatgc ctcggaggac      1500
     aaggctcgcc gcgaggaggc ggagacccgc aaccaggccg agtcgctggt caaccagacc      1560
     gagaagttcc tgtccgagaa cgccgataag gttccggccg agaacaagga gaaggtcgag      1620
     gccgccatca aggaggcgaa cgaggccctg cagggcaccg atatcgccgc cgtgaaggcc      1680
     gccgtcgaga agctgtcgac cgagtcgcag gctctgggcc aggcgctgta cgcgcaggcc      1740
     ggtgccgagg ctcaggcgga gggcgccgaa caggccgcgc aggcggatga cggtgtcgtc      1800
     gatgccgagg tcgtcgacga ggatccgaag gacgcgaagt aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page