(data stored in ACNUC1104 zone)

EMBL: CP001966.PE474

CP001966.PE474       Location/Qualifiers
FT   CDS_pept        516564..517163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0487"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rha:RHA1_ro05498 heat
FT                   shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77128"
FT                   /db_xref="GOA:D5US61"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D5US61"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADG77128.1"
FT                   /translation="MTTPENPVDPEEVNTEAEGVEAGTVTAAAEDSAAAAADEAGSTDA
FT                   PSDEVAELTADLQRVTAEYANYRKRTARDVVDARAAGKAAVVAELLVVLDDLDRARSHG
FT                   DLEAGPLKSVSDKLDGVLSGLGLAPFGAEGDEFDPSIHEAVQHEGDGADPVLGAVLRQG
FT                   YQIDGKVIRNAMVAVVDRPEPDASGQGATDADQDES"
     atgacgaccc ccgagaatcc ggtggatccg gaagaggtga acacggaggc tgagggggtc        60
     gaggcaggga ctgtcacggc cgcggcggag gattccgccg cggctgcggc cgatgaggcc       120
     ggcagcaccg acgcaccgtc ggacgaggtc gccgagctga ccgccgatct gcagcgcgtg       180
     accgccgagt acgccaacta ccgcaagcgc accgcgcgcg atgtggtgga cgcccgcgct       240
     gcgggtaagg cggcagtggt ggccgaactg ctggtggtgc tcgacgatct cgaccgcgca       300
     cgcagccacg gcgatctcga ggccggaccg ctcaagtccg tgtccgacaa gctcgacggt       360
     gtcctcagtg gtctcggtct cgcgccgttc ggcgccgagg gcgacgagtt cgatccgtcg       420
     atccacgagg ccgttcagca cgagggcgac ggtgccgacc ccgttctggg ggcggtactg       480
     cggcagggtt atcagatcga tggcaaggtg atccgcaacg cgatggtcgc cgtggtcgat       540
     cgccccgagc cggatgcatc cggccagggc gcgaccgacg ccgatcagga cgagtcctag       600
//

If you have problems or comments...

PBIL Back to PBIL home page