(data stored in ACNUC1104 zone)

EMBL: CP001966.PE476

CP001966.PE476       Location/Qualifiers
FT   CDS_pept        518382..518780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0489"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: rop:ROP_55750 putative heat shock protein
FT                   HspR; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77130"
FT                   /db_xref="GOA:D5US63"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5US63"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG77130.1"
FT                   /translation="MTRPPEIPDDPDAHVFMISVAAQLAGMHAQTLRTYDRLGLVKPER
FT                   SAGGGRRYSTRDVDLLREVQRLSQDEGVNLAGIKRIIDLTNQVDALQRRVQELTAQVDA
FT                   AHRSGAELVHVPKSSALVVWQPRTRRRD"
     atgacccgcc cgccggagat tcctgacgat ccggacgccc acgtgttcat gatctcggtg        60
     gccgcacagt tggccgggat gcatgcgcag acgctccgca cgtacgaccg cctcgggctc       120
     gtcaagcccg agcggtcggc gggcgggggt cggcgctact ccacccggga cgtggacctc       180
     ctgcgcgagg tgcagcggct ctcgcaggac gagggcgtga accttgccgg catcaaacgg       240
     atcatcgatc tgaccaacca ggtcgacgcc ctgcagcgcc gggtccagga gctcactgcg       300
     caggtggacg ccgcgcaccg ctccggcgca gaactggtgc acgtgcccaa gtccagcgcc       360
     ctcgtggtct ggcagccgcg cacccggcgc cgcgactga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page