(data stored in ACNUC1104 zone)

EMBL: CP001966.PE479

CP001966.PE479       Location/Qualifiers
FT   CDS_pept        complement(519886..521034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0492"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; globin;
FT                   KEGG: mkm:Mkms_0481 oxidoreductase FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77133"
FT                   /db_xref="GOA:D5US66"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5US66"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADG77133.1"
FT                   /translation="MGSHSRHGLTQIAADLRPVSDDFTKRLFARLFALDPSLRELFPAS
FT                   MSSHREVFFRVLDHVFSAIPEADEHDELIEFLAQLGRDHRKYGLTEAHYTTMATALSAE
FT                   VRALYQPHGGLDAEDSAVLDQAVQMMTGVMRGGAHSDPTPARRSAEVVEVLRPHPGLTV
FT                   VRLIAEQPLLFRPGQYVETQIPQVPRQWRPFSLAMPPNTQGQMEFHVRAVPGGDLSSTI
FT                   HSETRPGDRWQFGQVHGLMRADGARPVTLIAGGTGLAPMKSILLAMAASAHNPETHLVM
FT                   GARSPGQLYDAESLAMLAATNPWLRITQVTDARRDPWWLTTPAPPARGLPLRHGSVVEA
FT                   MRALDLRGHRVLIAGPAGLVHAARNTALSAGAEPDQVLHDPI"
     gtgggatcgc attcgcggca cggtctgacc cagatcgcag ccgacttgcg accggtctcg        60
     gacgatttca ccaaacgcct gttcgcgcgg ctgttcgcgc tcgatccatc gctgcgcgag       120
     ctgttcccgg ccagcatgtc ctcgcatcgc gaggtgttct tccgggtgct cgaccacgtc       180
     ttctccgcga tccccgaggc cgacgagcac gacgaactga tcgaattcct cgcgcaactg       240
     ggccgcgacc accgcaagta cggtctcacc gaagcgcact acaccacgat ggccaccgcc       300
     ctgtcggccg aggtgcgagc gctgtatcag ccgcacggtg gtctggatgc cgaggactcc       360
     gccgtactcg accaggccgt gcagatgatg acgggtgtga tgcgcggtgg agcgcactcc       420
     gacccgacgc ccgcccgccg cagcgccgag gtggtcgaag tgctgcggcc gcaccccggg       480
     ctcaccgtcg tccggctgat cgccgagcag ccgctcctgt tccgccccgg ccagtacgtg       540
     gaaacgcaga ttcctcaggt tcctcggcag tggcgcccgt tctccctggc gatgccgccg       600
     aacacccagg ggcagatgga gttccatgtt cgcgcggtgc cgggtggcga tctgtcgagc       660
     accattcact ccgaaacccg gcccggtgac cggtggcagt tcggacaggt tcacggactg       720
     atgcgggccg acggtgcgcg gccggtcacg ctgatcgccg gcggtaccgg gctcgcgccg       780
     atgaagtcga tcctgctggc catggctgcc agcgcgcaca atcccgagac tcacctggtg       840
     atgggcgcgc ggtcgccggg ccagctgtac gacgccgaat cgctggcgat gttggcggcc       900
     accaatccgt ggctgcggat cacccaggtg accgatgctc gccgcgatcc gtggtggctc       960
     acgacgcccg caccgccggc ccgcgggcta ccgctgcggc acggctcggt ggtggaggcg      1020
     atgcgcgccc tcgatctgcg cgggcaccgg gtcctgatcg ctggccccgc cggcctggtg      1080
     catgccgcgc ggaacacggc gctcagcgcc ggcgcggaac cggatcaggt tctgcacgac      1140
     ccgatctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page