(data stored in ACNUC1104 zone)

EMBL: CP001966.PE48

CP001966.PE48        Location/Qualifiers
FT   CDS_pept        50270..51568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0048"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: nfa:nfa54830 putative lipase; PFAM: secretory
FT                   lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76702"
FT                   /db_xref="GOA:D5UPT4"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT4"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ADG76702.1"
FT                   /translation="MTAVTTRLETAEQWPAPAEPQQVGIDPFFDAPEGFADVPAGTVLR
FT                   YRDVTVGFLGRIKQRVRATQLLYRTVNMHGDPEVTTTTVLRPRRGAKPGAPLVSYQCAI
FT                   DSLHPKTFPSYVLQHGVRTEDASFPQIEYLFIAAAVAKGWTVSVPDHGGQTGRWGIPRE
FT                   PGHMVLDGLRACLAHAPFDLAPDTRIGVWGYSGGGLATVWAAETAPSYAPELNLIAGAV
FT                   GAPVSDPGNVFVYLNNTLFTGLPTLVIAALAREYPTLREVLAEHVDDKGRKLFYEDALE
FT                   WSPERAIRKMAHKDFGYYCDLPFEEIARLPKLLEIFDDIRPGQSAPAVPMLVVQSTKDQ
FT                   ISPADDATAHVQRYAAGGTHVEYRTDQWSDHFSMHFMSAPMLLGWLTDRLDGKPVGAAG
FT                   HRHSRSIMASPRQIGRTLRLVGTAARVAAGGRF"
     atgacggccg tgaccacgcg cctcgagacc gccgagcagt ggcccgcacc cgcggagccg        60
     cagcaggtgg gcatcgaccc gttcttcgac gcccccgaag gattcgcgga cgtccccgcg       120
     ggcaccgtgc tgcggtaccg cgacgtcacc gtcggcttcc tcggccggat caagcagcgg       180
     gtgcgtgcca cccagctgct gtaccgcacc gtgaacatgc acggtgaccc cgaggtcacc       240
     accaccaccg tgctgcgccc gcgccgcggc gcgaagcccg gcgccccgct ggtgtcctac       300
     cagtgcgcga tcgattcgct gcaccccaag accttcccgt cgtacgtgct ccagcacggc       360
     gtgcgcaccg aggacgcctc gttcccgcag atcgagtacc tcttcatcgc ggccgccgtc       420
     gccaagggct ggacggtctc ggtccccgac cacggtggcc agaccggccg ctggggcatt       480
     cctcgcgaac ccggccacat ggtgctcgac ggtctgcgtg cctgcctcgc gcatgcgccc       540
     ttcgatctgg cacccgacac ccggatcggt gtctggggct actccggcgg aggcctcgcc       600
     accgtctggg ccgcggagac ggcaccgtcg tacgcgcccg aactgaacct gatcgccggc       660
     gccgtgggcg ctcccgtctc cgatcccggc aatgtcttcg tctacctcaa caacaccctg       720
     ttcaccggcc tccccacgct cgtgatcgcc gcgctggccc gggagtatcc gacgctgcgc       780
     gaggtgctgg ccgagcacgt ggacgacaag ggccgcaagc tgttctacga ggacgccctc       840
     gaatggtcgc ccgagcgggc catccggaag atggcgcaca aggacttcgg ctactactgc       900
     gacctcccgt tcgaggagat cgcccggctg cccaagctgc tcgagatctt cgacgacatc       960
     cgccccggcc agtcggcgcc cgcggtaccg atgctggtgg tgcagtccac caaggatcag      1020
     atatcgcccg ccgacgatgc caccgcgcac gtgcagcggt acgcggccgg cggcactcac      1080
     gtcgaatacc gcaccgacca atggagcgac cacttctcga tgcacttcat gtcggcgccg      1140
     atgctgctcg gctggctgac ggaccggctc gacggtaagc cggtcggcgc cgccgggcat      1200
     cggcacagcc gctcgatcat ggcctcgccg aggcagatcg gccgcaccct gcggctggtg      1260
     ggcaccgcgg cgcgggtcgc cgccggcggc cgcttctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page