(data stored in ACNUC1104 zone)

EMBL: CP001966.PE481

CP001966.PE481       Location/Qualifiers
FT   CDS_pept        522331..524871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0494"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; Clp ATPase-like; AAA ATPase central
FT                   domain protein; Torsin; ATPase associated with various
FT                   cellular activities AAA_5; Clp domain protein; KEGG:
FT                   rha:RHA1_ro05514 ATP-binding subunit of heat shock protein
FT                   ClpB; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77135"
FT                   /db_xref="GOA:D5US68"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D5US68"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADG77135.1"
FT                   /translation="MDSFNPTTKTQAALTSALQAASAAGNPEISPAHLLVALLDQTDGI
FT                   AAPLLKAVGVDPVTVRNRAQELVDRKPKASGSTTQPQLSRESLASITAAQKLATEMGDQ
FT                   YVSTEHVLYGLSEAAQVLGNAGATPQAIQEAFTAVRGSAKVTSQDPEGQYQALEKYSTD
FT                   LTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRVVTG
FT                   DVPESLRGKTVISLDLGSMVAGAKYRGEFEERLKAVLDEIKASSGQIITFIDELHTIVG
FT                   AGATGDSAMDAGNMIKPMLARGELRLVGATTLDEYRQYIEKDAALERRFQQVLVGEPSV
FT                   EDTIGILRGLKERYEVHHGVRITDSALVSAASLSDRYITSRFLPDKAIDLVDEAASRLR
FT                   MEIDSRPEEIDAEERIVRRLEIEEMALSKETDAASVDRLEKLRGELADHKEKLAQLTSR
FT                   WQNEKGAIDSVRTLKEQLENLKGESDRAERDGDLGRAAELRYGQIPALEKELDEAVAAS
FT                   GAASDGEVMLKEEVGPDDVADVVSSWTGIPAGRMLEGETAKLLRMESEIGKRVIGQEAA
FT                   VEAVSDAVRRTRAGVADPNRPTGSFLFLGPTGVGKTELAKGLAEFLFDDERAMVRIDMS
FT                   EYGEKHSVARLVGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEVEKAHPDVFDVLLQVL
FT                   DEGRLTDGQGRTVDFRNTILILTSNLGAGGDKDHVMNAVRAKFKPEFINRLDDVLIFDS
FT                   LDSGQLTGIVDIQLDQLRKRLSQRRLDLQVSDEAKGWLAERGFDPLYGARPLRRLVQQS
FT                   IGDQLAKALLAGDVRDGDPVKVTVSEDGDRLIIN"
     gtggattcgt tcaaccccac taccaagacg caggccgcgc tcacgtcggc gctgcaggcg        60
     gcgtccgccg cgggcaaccc ggagatttct ccggcgcacc tgctggtggc gctgctggac       120
     cagaccgacg gtatcgccgc gccgctgctc aaggcagtgg gcgtcgatcc cgtcacggtg       180
     cgcaaccgtg cacaggagct cgtggaccgc aagcccaagg ccagcggttc caccacccag       240
     ccgcagctga gccgcgaatc actcgcgtcg atcacggccg cacagaagct cgccaccgag       300
     atgggcgacc agtacgtctc caccgagcac gtgctctacg gtctgtccga ggccgcccag       360
     gttctcggca acgccggcgc caccccgcag gcgatccagg aggccttcac cgccgtccgc       420
     ggcagcgcga aggtcacctc gcaggatccc gagggtcagt accaggcgct ggagaagtac       480
     tcgaccgatc tcaccgcgcg ggcccgcgag ggcaagctcg acccggtgat cgggcgcgac       540
     aatgagattc ggcgcgtggt gcaggtgctc agccggcgca ccaagaacaa tccggtgctg       600
     atcggcgagc ccggcgtcgg caagaccgcc atcgtcgagg gcctggccca gcgcgtggtc       660
     acgggcgatg tgcccgagtc gttgcggggt aagaccgtga tctcactgga cctcggctcg       720
     atggtcgcgg gcgccaagta ccgcggcgag ttcgaggagc ggctcaaggc cgtgctcgat       780
     gagatcaagg ccagctccgg acagatcatc accttcatcg atgagctgca caccatcgtc       840
     ggcgccggtg ccaccggcga ttccgcgatg gacgccggca acatgatcaa gccgatgctg       900
     gcccgcggtg agctgcgcct cgtgggcgcc accacgctcg atgagtaccg gcagtacatc       960
     gagaaggacg ccgcgctcga acgccgcttc cagcaggtgc tggtgggcga gccgagcgtg      1020
     gaggacacca tcggcatcct gcgcgggctc aaggagcgct acgaggtgca ccacggcgta      1080
     cgcatcaccg actccgcgct ggtctcggcc gcgtcgctgt cggaccgcta catcacgtca      1140
     cggttcctgc ccgacaaggc gatcgacctc gtcgacgagg ccgcctcgcg cctgcgcatg      1200
     gagatcgact cccgcccgga ggagatcgat gcggaggagc gcatcgtgcg ccgcctcgag      1260
     atcgaggaga tggcgctgtc caaggaaacc gatgcggcct ccgtcgatcg gctggagaag      1320
     ctgcgcggcg agctcgccga tcacaaggag aagctggccc agctcacctc ccgctggcag      1380
     aacgagaagg gcgccatcga ttcggtgcgc accctcaagg agcagttgga gaacctcaag      1440
     ggcgaatccg atcgcgccga gcgcgacggt gacctcggcc gcgccgcgga gctgcgctac      1500
     ggccagatcc ccgcgctgga gaaggaactc gacgaggccg tggccgcatc gggtgccgcc      1560
     tccgacggcg aggtgatgct caaggaggag gtcggtcccg acgatgtggc cgatgtggtc      1620
     tcctcctgga ccggtattcc cgcgggccgc atgctcgaag gtgagaccgc caagctgttg      1680
     cgcatggaat ccgagatcgg taagcgcgtg atcggccagg aggccgctgt ggaggcggtc      1740
     tcggatgcgg tgcgccgcac ccgcgccggt gtcgccgacc cgaaccggcc caccgggtcc      1800
     ttcctgttcc tcggtcccac gggtgtgggt aagacggagc tcgcgaaggg cttggcggag      1860
     ttcctgttcg acgacgagcg ggccatggtg cgcatcgata tgtccgagta cggcgagaag      1920
     cactccgtcg ctcggctggt cggcgcgcct cccggctacg tcggctacga ggccggcggt      1980
     cagctgaccg aggcggtgcg gcgccgcccc tacacggtgg tgctgttcga cgaggtcgag      2040
     aaggcgcacc cggatgtctt cgacgtgctg ctgcaggtgc tcgacgaggg tcggctcacc      2100
     gatggtcagg gtcgcaccgt ggacttccgc aacacgatcc tgatcctcac gtcgaacctc      2160
     ggtgcgggcg gcgacaagga ccacgtgatg aacgcggtgc gggccaagtt caagccggag      2220
     ttcatcaacc ggctcgacga tgtgctcatc ttcgactcgc tcgactccgg acagctcacc      2280
     ggcatcgtcg acatccagct cgatcagctg cgcaagcggc tctcgcagcg ccgactcgac      2340
     ctccaggtct ccgatgaggc gaaggggtgg ctcgcggagc gcggtttcga cccgctctac      2400
     ggtgcccgtc cactgcgccg cctggtgcag cagtcgatcg gcgaccagct cgccaaagcg      2460
     ctgctcgcgg gcgacgtccg cgacggtgac ccggtgaagg tcaccgtcag cgaggacggc      2520
     gaccggttga tcatcaactg a                                                2541
//

If you have problems or comments...

PBIL Back to PBIL home page