(data stored in ACNUC1104 zone)

EMBL: CP001966.PE483

CP001966.PE483       Location/Qualifiers
FT   CDS_pept        526026..526406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0496"
FT                   /product="PPOX class putative F420-dependent enzyme"
FT                   /note="KEGG: rha:RHA1_ro00170 hypothetical protein;
FT                   TIGRFAM: PPOX class probable F420-dependent enzyme; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77137"
FT                   /db_xref="GOA:D5US70"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:D5US70"
FT                   /inference="protein motif:TFAM:TIGR03666"
FT                   /protein_id="ADG77137.1"
FT                   /translation="MSAATVGSVADAKYVMLTTYRKDGSAVSTPLWAVRDGADLVMWTV
FT                   TDSWKVKRIRKNPAVLVQACDVRGKKTEGPQVAGVAEIVDGADAGQRIQRKYGILGFLT
FT                   VAGSKIRRGQGGTVGIRVRDAS"
     atgagtgcag ccacggtcgg aagtgtcgcc gacgccaagt acgtcatgct caccacctac        60
     cgcaaggacg gcagcgcggt gtcgaccccg ctctgggccg tgcgcgacgg cgccgatctg       120
     gtgatgtgga ccgtcaccga ctcgtggaag gtcaagcgca tccgcaagaa ccccgcggtc       180
     ctggtgcagg cctgcgatgt ccgcggcaag aagaccgaag ggccgcaggt cgcgggtgtg       240
     gccgagatcg tcgacggcgc cgacgccggt cagcggatcc agcgcaagta cggcatcctc       300
     ggcttcctca ccgtggccgg ctccaagatc cgacggggtc agggcggcac cgtcggcatc       360
     cgcgtccgcg acgcctcctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page