(data stored in ACNUC1104 zone)

EMBL: CP001966.PE487

CP001966.PE487       Location/Qualifiers
FT   CDS_pept        complement(528902..529288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0500"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   mlu:Mlut_04300 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77141"
FT                   /db_xref="GOA:D5US74"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D5US74"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ADG77141.1"
FT                   /translation="MTPASVVAVRNLWPPRELTEGESPDARFTLANERTFLAWIRTALG
FT                   LVAAAVGLEAFAPDVVPAAVRTPLVVILLVVAAGLAGYAFRRWLSVEGAMRTGRPLRGS
FT                   PATVVLAAVIAVTGLILAATIAFT"
     gtgacccccg ctagcgttgt cgccgtgcgc aatctctggc cgccccgcga gctcaccgag        60
     ggcgaatcac cggatgcgcg attcactttg gcgaatgaac gcaccttcct ggcgtggatc       120
     cgcacggcac tggggctggt cgccgccgcg gtcgggctgg aagccttcgc ccccgacgtg       180
     gtgcccgccg cggtacgcac gccactggtg gtgatcctgc tggtggtggc ggccggcctc       240
     gccggatacg ccttccgccg ctggctgtcg gtggaggggg cgatgcgcac cggccgaccg       300
     ctgcgcggat cgcctgccac ggtggtgctc gcggcggtca tcgccgtgac cggcctcatc       360
     ctcgctgcga cgatcgcgtt cacgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page