(data stored in ACNUC1104 zone)

EMBL: CP001966.PE488

CP001966.PE488       Location/Qualifiers
FT   CDS_pept        529410..529856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa54010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77142"
FT                   /db_xref="GOA:D5US75"
FT                   /db_xref="UniProtKB/TrEMBL:D5US75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77142.1"
FT                   /translation="MGGETRSRGPWLATVLSLLGIGVVGAGLAYSLHIASELGSVRRDA
FT                   APAVSSGVPVNQKVSGVAITPGREVIGAILSIDASALTVSSAPGGNTVDLRTDENTQVT
FT                   TTHGSKLTDLKVGDVVIIQVSADGETALAIYAGQISVAGTPSVG"
     atgggcggtg aaacgcgatc acgcggcccc tggctcgcca cggtcctcag tctcctcggt        60
     atcggcgtgg tcggtgcggg cctcgcatac agcctgcaca tcgcatccga actgggttcc       120
     gtgcggcgcg acgcggcgcc cgcggtgtcc tccggcgtcc ccgtgaatca gaaggtctcc       180
     ggtgtcgcca tcacccccgg gcgcgaagtg atcggggcga tcctcagcat cgatgcgagc       240
     gccctcacag tgagctccgc acccggaggc aacaccgttg acctgcgcac cgacgagaac       300
     acgcaggtga ccacgacgca cgggagcaaa ctcaccgacc tcaaggtggg cgatgtggtg       360
     atcatccagg tgagcgccga cggcgagacc gccctggcga tctacgccgg tcagatctcc       420
     gtcgccggca cgccatcggt cgggtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page