(data stored in ACNUC1104 zone)

EMBL: CP001966.PE491

CP001966.PE491       Location/Qualifiers
FT   CDS_pept        531138..531836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0504"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   rop:ROP_56060 putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77145"
FT                   /db_xref="GOA:D5US78"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5US78"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADG77145.1"
FT                   /translation="MTDPDAAAGAEAGPTEWITGVAGPHTVGLGPWEQEHPGVPLPVDP
FT                   RYDPDLLAQGDRRNVVDAYRYWTREAIVADLDSRRHPFEVAIENLGHDANIGTVVRTAN
FT                   AFGARTVHIVGRRRWNRRGAMVTDRYQHVQHHPDAESFAAWCAEHDLPIVAVDNQPGSV
FT                   PLERGSLPRRCVLLFGQEGPGVSGDARRVAGTTVSIAQFGSTRSINVGVAAGIAMHAWV
FT                   REHADLDAAW"
     gtgaccgacc ccgacgcagc cgccggcgcg gaggccggcc ccaccgaatg gatcacgggc        60
     gtcgcgggtc cgcataccgt cgggttgggg ccgtgggagc aggagcatcc cggcgtgccg       120
     ctgccggtcg atccccgata cgacccggac ctgctcgccc agggggatcg ccgcaacgtg       180
     gtcgacgcct atcggtactg gacgcgcgag gcgatcgtcg ccgatctgga cagccgccga       240
     cacccgttcg aggtggccat cgagaaccta ggccacgatg ccaacatcgg cacggtggtg       300
     cgcacggcca atgccttcgg ggcgcggacg gtgcatatcg tgggacgtcg tcggtggaat       360
     cgtcggggcg ccatggtgac cgaccgctac cagcacgtgc agcatcaccc ggacgccgag       420
     tccttcgcgg cgtggtgcgc cgaacacgac cttccgatcg tcgcggtgga caatcagccc       480
     ggatcggtgc cgctggaacg tggctcgctc ccgcgccgct gtgtcctgct gttcggccag       540
     gaggggcccg gtgtttccgg tgatgcccgc cgcgtggcgg gaacgacggt gtcgatcgcc       600
     cagttcggct cgacgcgctc gatcaatgtg ggggtcgcgg ccggtatcgc catgcacgcc       660
     tgggtacgcg aacacgccga cctggacgcc gcctggtag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page