(data stored in ACNUC1104 zone)

EMBL: CP001966.PE494

CP001966.PE494       Location/Qualifiers
FT   CDS_pept        complement(535339..536988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0507"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rer:RER_45590 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77148"
FT                   /db_xref="GOA:D5US81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5US81"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG77148.1"
FT                   /translation="MTVLQARDLSVAYADRSLFSGLDLVIAPGDVVGLVGANGAGKSTL
FT                   LALLAGLHADGGPEVTGTVEKSPADAQVGYLAQEPERRPGETVAQFVARRTGVAAAEAE
FT                   MNAAAEALAVDPAEDRYTPALDRWLALGGADLDQRLTTILSEVGLPDPEAEMTGLSGGQ
FT                   AARAGLAAVLASRYDVLLLDEPTNDLDLAGLELLERFVVSSSAATALVLVSHDREFLAR
FT                   TVTTVVELDLAQQQIGVYGGGYEAYLVERDVARRHAREEYEQYAGKLSDLQDRAQMQRN
FT                   WMEHGVRNARRKMKNGDPDKAGRKARLESTEKQASKARQTERAIERLEVVEEPRKEWEL
FT                   RMEIAAAPRSGTVVATLSGATVRYPQLTVGPITAAVEYGDRILLTGPNGAGKSTLLALL
FT                   LGRRAPSAGTATLGSGVEIGEIDQARGRFLGDDALLDAFCAEVPETSPADVRTLLAKFG
FT                   LRGHHVLRPAASLSPGERTRAALALLQARGVNLLVLDEPTNHLDLPAIEQLEQAVESFD
FT                   GTVILVTHDRRMLDTVRATRRWRMEAGHMHEG"
     gtgaccgtcc tccaggcgcg cgatctgtcg gtcgcctacg ccgaccgcag cctgttctcc        60
     ggcctcgatc tggtgatcgc ccccggcgac gtcgtcgggc tggtcggcgc caacggtgcc       120
     ggcaaatcga ccctgctcgc gctgctcgcc gggttgcacg ccgacggcgg gccggaggtc       180
     acgggcaccg tcgagaagtc ccccgccgat gcccaggtgg gatacctggc acaggagccc       240
     gaacgtcggc cgggcgagac ggtcgcgcag ttcgtggccc ggcgtaccgg tgtcgccgcg       300
     gcggaggccg agatgaacgc cgcggcggaa gccctggcgg tcgaccccgc cgaagaccgg       360
     tacacccccg ccctcgaccg gtggctcgcg ctcggcggcg cagacctcga ccagcgactg       420
     acgacgatcc tctccgaggt cggcctgccc gatccggagg cggagatgac ggggctctcg       480
     ggcgggcagg ccgcccgcgc gggcctcgcg gcggtgctgg catcccgata cgacgtactg       540
     ctgctcgacg agccgaccaa tgacctcgat ctcgcgggcc tggagctgct ggagcgcttc       600
     gtcgtcagca gctcagccgc gacggccttg gttctggtct cgcacgaccg ggagttcttg       660
     gcccgcaccg tgaccacggt ggtcgagctc gatctcgcgc agcagcagat cggggtgtac       720
     ggcggcggct acgaggccta cctggtggag cgcgacgtcg cgcggcggca cgcccgcgag       780
     gagtacgagc agtacgcggg caagctctcg gatctgcagg accgcgcgca gatgcagcgg       840
     aattggatgg aacacggtgt gcgcaacgcg cgccggaaga tgaagaacgg cgaccccgac       900
     aaggcgggcc ggaaggcgcg gctggaatcg accgagaagc aggcctcgaa ggcgcggcag       960
     accgagcgcg ccatcgagcg gctcgaggtg gtcgaggagc ctcgcaagga gtgggagctg      1020
     cggatggaga tcgccgccgc gccgcgcagc ggcaccgtgg tcgccaccct gtccggcgcc      1080
     accgtccggt acccgcagct caccgtcggg ccgatcacgg cggcggtgga gtacggcgac      1140
     cggatcctgc tgaccgggcc gaacggcgcc ggtaaatcga cgctgctcgc gctgctgctc      1200
     gggcgccgcg caccgtcggc cgggacggcg accctgggct ccggcgtcga gatcggtgag      1260
     atcgaccagg cccgtgggcg tttcctcggc gacgatgcgc tattggacgc cttctgcgct      1320
     gaggtgcccg aaacgtcacc cgccgatgtc cgcactctgc tggcgaagtt cgggctgcgc      1380
     ggacatcacg tgctgcgacc ggccgcgtca ctctcaccgg gtgagcgcac ccgcgccgct      1440
     ctcgccctgc tgcaggctcg cggggtcaac ctgttggtgc tcgacgaacc gaccaaccac      1500
     ctcgatctgc ccgccatcga gcagttggag caggccgtcg aatccttcga cggcacagtc      1560
     atcctggtga cccacgaccg acgcatgctg gacaccgtgc gcgccacccg ccgctggcgg      1620
     atggaagccg gccacatgca cgagggatga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page