(data stored in ACNUC1104 zone)

EMBL: CP001966.PE495

CP001966.PE495       Location/Qualifiers
FT   CDS_pept        complement(536988..537623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0508"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rha:RHA1_ro05534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77149"
FT                   /db_xref="GOA:D5US82"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D5US82"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG77149.1"
FT                   /translation="MLEFVQNAGPVMIWLVVAGFVFAECAFIIGLFLPGDSLLLTAGLA
FT                   MATTGHSAASVWGLALAAFLAAIAGNHVGYGIGEKMGDHVLAKQDGRYLNAHNLHRVKE
FT                   LMDKHGFFSVLIARWIPWVRTLCPLVAGAVGMDKRKFTIASVLGSLIWAPFLLLVGYYA
FT                   SSALQDYKWVLDWALRGMIVMLVVGTVVGIIGYRREMAKPNVSVDLED"
     gtgctcgaat tcgtccagaa cgccgggccg gtgatgatct ggctcgtcgt ggccggattc        60
     gtcttcgccg aatgcgcgtt catcatcggg ctgttcctgc cgggcgactc gctgctgctc       120
     accgcgggtc tcgcgatggc caccaccggg cactccgcgg cctcggtgtg ggggctcgcg       180
     ctcgccgcct tcctcgccgc catcgccggt aaccacgtgg gctacggcat cggcgagaag       240
     atgggcgatc acgtgctcgc caaacaggac ggccgctacc tcaacgcgca caatctgcat       300
     cgggtcaagg agctgatgga caagcacgga ttcttctccg tgctcatcgc ccgctggatc       360
     ccatgggtgc gcaccctgtg cccgctcgtc gccggcgcgg tgggcatgga caagcggaag       420
     ttcaccatcg cctcggtcct cggctcgctg atctgggctc cctttctcct gctggtcggc       480
     tactacgcct cgtcggccct ccaggactac aagtgggtcc tggactgggc gctgcgcggc       540
     atgatcgtga tgctcgtcgt gggcaccgtc gtggggatca tcggctaccg gcgtgagatg       600
     gccaaaccga acgtctccgt cgatctcgag gactag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page