(data stored in ACNUC1104 zone)

EMBL: CP001966.PE496

CP001966.PE496       Location/Qualifiers
FT   CDS_pept        complement(537632..538351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0509"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rer:RER_14110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77150"
FT                   /db_xref="GOA:D5US83"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D5US83"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG77150.1"
FT                   /translation="MYFTDLTLATSTTLQAFSISDITDPVAVLNAFGPIALVGLLLVVF
FT                   IESGVLFPVLPGDSLLFVAGLLTAAGTGAAVGEATYTGSAMSLPVLLIGVPIAAILGSQ
FT                   VGYFIGRFGGEKLFKPDARFLKTKYLDESHEFFEKYGPATLVLARFVPFVRTFAPVAAG
FT                   AAHMNYVKFVIWNAIGAIIWGDGILLLGVWLGQIDWVRDNIDKIFIGIVLVSVLPIVWG
FT                   VAKKYLSDRRANSSASA"
     gtgtatttca ctgacctgac gctggccacc tcgaccaccc ttcaggcctt ctcgatctcg        60
     gacatcaccg accccgtcgc cgtcctcaac gccttcggcc cgatcgccct ggtgggcctg       120
     ctgctggtcg tgttcatcga gtccggcgtg ctgttccccg tgctccccgg cgattcgctg       180
     ctgttcgtcg ccggcctgct caccgccgcc ggcaccggcg cggcggtcgg tgaggccacg       240
     tacaccggct cggcgatgtc gctccccgtg ctgctgatcg gcgtgcccat cgccgcgatc       300
     ctcggctcgc aggtgggcta cttcatcggc cgtttcggcg gcgagaaact gttcaagccc       360
     gacgcgcgct tcctcaagac caagtacctc gacgaatcgc acgagttctt cgagaagtac       420
     ggcccggcca cactggtgct ggcccgcttc gtgcccttcg tccgcacctt cgcgccggtc       480
     gccgcgggcg ccgcgcacat gaactacgtg aagttcgtca tctggaacgc catcggcgcc       540
     atcatctggg gcgacggcat cctgctgctc ggcgtctggc tgggccagat cgactgggtg       600
     cgcgacaaca tcgacaagat cttcatcggt atcgtcctgg tctccgtgct gcccatcgtg       660
     tggggcgtcg cgaagaagta cctgtcggac cgccgcgcga actcctccgc cagcgcgtag       720
//

If you have problems or comments...

PBIL Back to PBIL home page