(data stored in ACNUC1104 zone)

EMBL: CP001966.PE498

CP001966.PE498       Location/Qualifiers
FT   CDS_pept        540292..541320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0511"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: rha:RHA1_ro05536 fructose-bisphosphate
FT                   aldolase; TIGRFAM: fructose-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77152"
FT                   /db_xref="GOA:D5US85"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5US85"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADG77152.1"
FT                   /translation="MPIATPEAYREMLDRARKGGYAFPAINCTSSETINAAIKGFADAG
FT                   SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFAHVVAAKYDVTVALHTDHCPKDKLDG
FT                   LVRPLLEISQERVNNGQNPLFQSHMWDGSAVPLEENLEIAQELLAKCKAANIILEIEIG
FT                   VVGGEEDGVENEINDKLFTSNEDFAKTVDALGTDGYLLAATFGNVHGVYKPGNVKLRPS
FT                   VLRDGQAVAAQKQGLPEGSKPFSFVFHGGSGSLKSEIEESLSYGVVKMNVDTDTQYAFT
FT                   RPVAGHMFSNYDGVLKIDGEVGNKKTYDPRSYLKKAETSMAERVVEACNDLHSAGKSIS
FT                   AK"
     atgcccatcg caacccccga ggcctaccgg gagatgctgg accgcgctcg gaagggcggt        60
     tacgccttcc cggccatcaa ctgcacgtcg agcgagacga tcaacgcggc gatcaagggc       120
     ttcgccgacg ccggcagcga cggcatcatc cagttctcga ccggtggcgc ggagttcggt       180
     tcgggcctgg gtgtgaagga catggtcacc ggcgccgtcg cgctcgccga gttcgcgcac       240
     gtcgtggcgg cgaagtacga cgtcaccgtc gcgctgcaca ccgaccattg cccgaaggac       300
     aagctcgacg gcctggtccg tcccctgctg gagatctcgc aggagcgcgt gaacaacggc       360
     cagaacccgc tgttccagtc ccacatgtgg gacggctccg cggtgccgct ggaggagaac       420
     ctggagatcg cgcaggagct gctggccaag tgcaaggcgg ccaacatcat cctggagatc       480
     gagatcggcg tggtcggcgg tgaggaggac ggcgtcgaga acgagatcaa tgacaagctg       540
     ttcaccagca acgaggactt cgcgaagacg gtcgacgcgc tcggcaccga cggctacctg       600
     ctggccgcca ccttcggcaa cgtccacggc gtctacaagc cgggcaacgt caagctgcgc       660
     ccgtccgtgc tgcgcgacgg ccaggccgtg gccgcgcaga agcagggcct gccggagggc       720
     agcaagccct tctcgttcgt cttccacggc ggctcgggct cgctcaagag cgagatcgag       780
     gagtcgctga gctacggcgt ggtgaagatg aacgtggaca ccgacaccca gtacgccttc       840
     acccgcccgg tggccggtca catgttcagc aactacgacg gtgtgctgaa gatcgacggc       900
     gaggtgggca acaagaagac ctacgatccg cggtcgtacc tgaagaaggc cgagacctcg       960
     atggccgagc gcgtcgtcga ggcctgtaac gacctgcact cggcggggaa gtcgatcagc      1020
     gcgaagtag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page