(data stored in ACNUC1104 zone)

EMBL: CP001966.PE500

CP001966.PE500       Location/Qualifiers
FT   CDS_pept        complement(541855..543582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_56120 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77154"
FT                   /db_xref="GOA:D5US87"
FT                   /db_xref="UniProtKB/TrEMBL:D5US87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77154.1"
FT                   /translation="MARDSYRRAFSRVRDQVAPRVSEGAKNAYTAYRNYRQSREANRPD
FT                   VRAASTAGSLGSAPGDAVTPSHSDSLAELVEQAAPPAAPSEAETTAFAATPKDDTATSK
FT                   TVGASDAETRVIPVAQRGGADADEAPADDAETPADADEDRTESGPAAPSEAETRAFAVV
FT                   QRDAVESPSDDATDDATDTPDEAASDEETAADASPSPLRTVGPVATTPPVEEGTDADSG
FT                   EADADAGDAPDDEAPADEADTEPDEDTAVDDEAATTEESGDDDAAPDDETTPEPAAPSP
FT                   LRTVGPTATAPPAADTPASDDADEADEVGAADEGEDSDDEPATEVIAVADTVSQDDADT
FT                   DADAATEAIPVAAPSNPDQAAIDTEQNELPDATPATETIPLTGAAAAAAAAAPTHQAPA
FT                   LPADNPTERSVPEYYAPTTQRPLPEQSGGNRWKWIAAGVVVVIAAIVGIVLLVSGGAGG
FT                   ADQTDPRVQAATSTTDFVGAINSGDLNALRAQTCGAAKQYYDRISTDEYQRVHDNAKAD
FT                   GLLPELDGLQAIDVNGDRAEVQVEVHYTGQPDAKVKNTLTLAKDEAGAWKVCTKMGDQ"
     atggctcggg attcataccg gcgggcgttc tcgcgagtgc gggatcaggt ggcaccgcgg        60
     gtttccgagg gcgccaagaa tgcgtacacc gcgtaccgca attatcgaca gtctcgggag       120
     gcgaaccgcc ccgatgtgcg agccgcgtcc accgcgggct ccctgggcag cgccccgggc       180
     gacgcggtga cgccgtcgca ctcggattcg ctggccgagc tggtcgagca ggcggcgccg       240
     ccagccgcac ccagcgaggc ggagaccacc gcgttcgcgg ccactccgaa ggacgacacc       300
     gccacctcga agaccgtggg tgcctccgat gcggagaccc gggtgatccc ggtggcgcag       360
     cggggcggag ccgacgccga cgaggctccg gcggacgatg ccgagacccc cgccgacgcc       420
     gacgaggatc gcaccgagtc cggtccggcg gcgccgagcg aggccgagac ccgtgccttc       480
     gccgtggtgc agcgcgacgc ggtggagtca ccctcggacg atgccaccga cgatgccacc       540
     gacactcccg acgaggccgc ctccgacgag gagacggccg cagatgcgtc accgtcaccg       600
     ctgcgcaccg tcggccccgt cgccaccacg cctcccgtgg aggagggcac cgatgccgac       660
     tccggcgagg ccgatgctga cgccggcgac gccccggacg acgaggcacc cgccgacgag       720
     gccgataccg agccggacga ggacacggcc gtcgacgacg aagccgccac gacggaagaa       780
     tccggtgacg acgacgccgc accggacgac gagaccacgc cggaaccagc tgcaccgtcg       840
     ccgctgcgca ccgtaggacc gaccgcgacc gcaccgcccg cggccgacac acccgcatcc       900
     gatgatgctg acgaggccga cgaggtaggt gccgccgacg agggcgagga ctccgacgac       960
     gagcccgcca ccgaggtgat cgcggtcgcc gacaccgtgt cgcaggacga cgccgacacc      1020
     gacgccgacg cggccaccga ggcgatcccg gtcgcggcac cgtcgaaccc ggatcaggcg      1080
     gcgatcgaca ccgaacagaa cgaactgccc gacgccacac ccgcgaccga gaccatcccg      1140
     ctcaccggcg ccgcggcggc cgctgccgcg gcggcgccca cccaccaggc accggcgctg      1200
     cccgccgata acccgaccga gcggtcggta cccgagtact acgcccccac cacccaacgc      1260
     ccgctacccg aacagtccgg cggaaaccgg tggaagtgga tcgcggccgg ggtcgtcgtg      1320
     gtgatcgccg cgatcgtcgg catcgtgctg ctggtgagcg gcggggccgg cggggcggac      1380
     cagacggacc cgagggtgca ggccgccacc agcacgaccg acttcgtcgg cgccatcaac      1440
     agcggcgatc tgaacgcact gcgcgcgcag acctgcggcg ctgccaagca gtactacgac      1500
     cggatcagca ccgacgagta ccagcgcgtc cacgacaacg ccaaggccga cggcctgctc      1560
     cccgagctcg acggcctgca ggcgatcgac gtcaacggcg accgcgccga ggtccaggtc      1620
     gaggtgcact acacgggtca gcccgacgcc aaggtcaaga acacgctcac gctggccaag      1680
     gacgaggcgg gcgcctggaa ggtgtgcacg aagatgggcg accagtga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page