(data stored in ACNUC1104 zone)

EMBL: CP001966.PE502

CP001966.PE502       Location/Qualifiers
FT   CDS_pept        544066..545232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_14150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77156"
FT                   /db_xref="GOA:D5US89"
FT                   /db_xref="UniProtKB/TrEMBL:D5US89"
FT                   /inference="similar to AA sequence:KEGG:RER_14150"
FT                   /protein_id="ADG77156.1"
FT                   /translation="MTPKPPASSASATSRLRRRHNALPEVIQSRTRRLWSSKLPILQCA
FT                   LAAGLAWYIAKDVVGHVSPFFAPIAAVISLGLSLNQRLRRSLELVGGVTVGIGVGDLLV
FT                   SQIGTGPWQLALVVAIAMSVAVLADRGPLVPMQAASSAVLIATLLPPGSAASWNRMLDA
FT                   LIGGLVGVIIAALIPNNPARRPRKDAAKVLDTMRRVVASIAAGLTDGDRASLDWALETA
FT                   RSTQPDLDQLTADLAGGIEIAKVSPVFWSSRGRMDRLQAIADPLDNAVRNVRVMARRAI
FT                   ASNQEAEKIDPALVTEIGRLAESFKTLRDVVLADPGAKPDQADAARVLRSAARRANELD
FT                   IGDGAPLNEVVIYAQLRSTIVDLLQVAGLKRTSAIAVLRARPTPEQPR"
     gtgaccccga agccgccggc cagctcggcc tcggcgacta gtcgccttcg gcgccggcac        60
     aacgcgctgc cggaggtcat ccagagccgc actcggcggt tgtggagttc caagctgccg       120
     atcctgcagt gcgcgctcgc ggcgggccta gcgtggtaca tcgcgaagga cgtggtcggc       180
     cacgtctcac cgttcttcgc gccgatcgcc gcggtcatct ccctcggcct ctcgctcaat       240
     cagcgattgc gtcgttccct ggagctggtc ggcggtgtca ccgtgggcat cggcgtcggc       300
     gatctgctgg tcagccagat cggcaccggc ccgtggcagc tcgctctggt ggtggcgatc       360
     gcgatgtcgg tcgcggtgct cgccgaccgc gggccgttgg taccgatgca ggcggcctcg       420
     tccgcggtgc tcatcgccac cctgctgcct ccggggtcgg cggccagctg gaaccgcatg       480
     ctcgatgccc tcatcggcgg tctcgtcggc gtgatcatcg ccgcgctgat cccgaacaat       540
     ccggcgcggc ggccccgcaa agacgccgcg aaggtgctcg acaccatgcg ccgggtcgtc       600
     gcgtccatcg cagccggtct caccgacggt gaccgggctt cgctcgactg ggccctggag       660
     acggcgcgct ccacccagcc cgatctcgac cagctcaccg cagatctggc gggcggcatc       720
     gagatcgcca aggtctcgcc ggtgttctgg agctcgcgcg gccggatgga tcggctgcag       780
     gcgatcgccg atccgctcga caacgccgtg cggaacgtgc gcgtcatggc ccgccgcgcg       840
     atcgcctcga accaggaggc cgagaagatc gaccctgcgc tggtcactga gatcggccgg       900
     ctcgcggaat cgttcaagac gctgcgcgat gtggtgctcg ccgaccccgg ggccaaaccc       960
     gaccaggccg acgccgcgcg ggtcctgcgc tctgcggcgc ggcgcgccaa cgaactggac      1020
     atcggcgatg gtgcgccgct caacgaggtg gtgatctacg cccagctgcg ctcgacgatc      1080
     gtcgacctgc tgcaggtggc cgggctcaaa cgcacctcgg cgatcgctgt gctgcgggcc      1140
     cggcccacgc cggaacaacc ccgttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page