(data stored in ACNUC1104 zone)

EMBL: CP001966.PE503

CP001966.PE503       Location/Qualifiers
FT   CDS_pept        complement(545237..545872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa53740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77157"
FT                   /db_xref="UniProtKB/TrEMBL:D5US90"
FT                   /inference="similar to AA sequence:KEGG:nfa53740"
FT                   /protein_id="ADG77157.1"
FT                   /translation="MSSVTQSTVVLRAPDVRIPAGLRDLETVTVDLDSVKAELKRKMPY
FT                   PRRLIVAGPDELLAAVIARLLAAERLDVEVAFAPTENSRASAIYPPGDPLTGVPRSVPL
FT                   IRDDRGFVLVGQARITGPDGGPLTGETFVDSEKLFTGQAKAIIVEPTGSGAGVRARLAK
FT                   GMRRKWLSGRAAQTGGLELVVTRDGRTDPSVVTRSTFYRHTDDWLLIS"
     gtgagctccg tgacccagag caccgtcgtg ctgcgtgcgc cagacgtccg tatccccgcc        60
     ggactgcgcg acctcgagac cgtcaccgtc gacctggatt cggtcaaggc cgaactcaag       120
     cggaagatgc cgtacccccg gcggctgatc gtcgccggcc cggacgaact gctggcggcg       180
     gtgatcgccc gcctgttggc ggccgaacga ctcgacgtgg aggtcgcctt cgcccccacc       240
     gagaactccc gcgcctcggc gatctacccg ccgggcgacc cgctcaccgg cgtaccgcgc       300
     tcagtgccgt tgatccgcga tgaccgcggt ttcgtgctgg tgggccaggc ccggatcacg       360
     ggacccgacg gtggcccgct caccggcgag accttcgtcg actcggagaa gctgttcacc       420
     ggtcaggcca aggcgatcat cgtcgagccc accggctccg gtgcgggggt acgcgcccgg       480
     ctggccaagg gcatgcgccg caagtggctc agcggtcgcg cggcgcagac cggcggactg       540
     gaactggtcg tcacccgcga cggtcgcacc gacccctcgg tggtgacccg ctcgaccttc       600
     taccggcata ccgacgactg gctgctgatc agctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page