(data stored in ACNUC1104 zone)

EMBL: CP001966.PE504

CP001966.PE504       Location/Qualifiers
FT   CDS_pept        545957..547243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0517"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: rha:RHA1_ro05551
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77158"
FT                   /db_xref="GOA:D5US91"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D5US91"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADG77158.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGEKLQWVVRYQGGNNAGHTVVL
FT                   PNGDKFALHLIPSGILTPGVKNVIGNGVVVDPSVLLQELDGLEARGVDTSNLLLSADAH
FT                   LLMPYHVAIDKVTERFLGNKKIGTTGRGIGPCYQDKIARVGVRAQDVLDESILTQKVEA
FT                   ALEFKNQVLTKIYNRRALDPRQVVDETLELAESFKHRIADTRLELNKALERGETVLLEG
FT                   SQGTLLDVDHGTYPFVTSSNPTSGGASVGSGIGPTRITTVLGILKAYTTRVGSGPFPTE
FT                   LFDEWGEYLAKHGGEVGVTTGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSIEN
FT                   VPICVAYEIDGVRYDEMPTTQSQVHHATPIFETMPGWWEDISECRTFEELPKNAQNYVL
FT                   RLEELSGAHISCIGVGPGRDETIVRRPIV"
     atgcccgcga tcgtgctgat cggtgcccag tggggcgacg agggtaaggg aaaggccacc        60
     gacctcctgg gggagaaact ccagtgggtg gtgcggtatc agggcggcaa caacgccggc       120
     cataccgtgg tcctgcccaa cggcgacaag ttcgccctcc atctgattcc atcgggcatt       180
     ctcaccccgg gcgtgaagaa cgtcatcggc aacggcgtcg tggtcgatcc gtcggtcctg       240
     ttgcaggagc tcgacggtct tgaggctcgc ggcgtggaca cctcgaatct gctgctctcg       300
     gccgacgcac accttctgat gccgtaccac gtggccatcg acaaggtcac cgagcgcttc       360
     ctcggtaaca agaagatcgg caccacgggc cgcgggatcg gaccctgcta ccaggacaag       420
     atcgcccgcg tcggcgtgcg cgcccaggac gtgctggacg agtcgatcct cacccagaag       480
     gtcgaggcgg ccctggagtt caagaaccag gtgctcacca agatctacaa ccgccgcgcc       540
     ctcgacccgc gccaggtggt cgatgagacg ctggagctgg cggagagctt caagcaccgc       600
     atcgccgaca cccgcctcga gctgaacaag gcgctcgagc gcggcgagac cgtgctgctg       660
     gagggctcgc agggcactct gctcgatgtg gaccacggca cctatccgtt cgtcacctcg       720
     tcgaacccca cctccggcgg tgcgtcggtg ggctcgggta tcgggcccac gcgcatcacc       780
     acggtgctgg gcatcctcaa ggcgtacacc acccgcgtcg gctcgggccc gttcccgacg       840
     gagctgttcg acgagtgggg cgagtacctc gccaagcacg gcggcgaggt gggcgtcacc       900
     acgggccgcg cccgccgctg cggctggttc gacgccgtga tcgcccgcta tgccacccgc       960
     gtcaacggca tcaccgatta cttcctcacc aagctcgacg tgctcagctc catcgagaac      1020
     gtgccgatct gcgtggccta cgagatcgac ggtgtccgct acgacgaaat gcccacgaca      1080
     cagtcgcagg tgcaccacgc cacgccgatc ttcgagacga tgcccggctg gtgggaggac      1140
     atctcggaat gccgcacctt cgaggagctg ccgaagaacg cgcagaacta cgtgctgcgg      1200
     ctcgaggaac tctccggtgc gcacatctcg tgcatcggtg tggggcccgg ccgtgacgag      1260
     acgatcgttc gccgccccat cgtctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page