(data stored in ACNUC1104 zone)

EMBL: CP001966.PE505

CP001966.PE505       Location/Qualifiers
FT   CDS_pept        547457..549109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6766 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77159"
FT                   /db_xref="UniProtKB/TrEMBL:D5US92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77159.1"
FT                   /translation="MKLKSIRSGALTSVLAVATVVGVVGAQLAVPPTAERSSPGVEYVL
FT                   TAGDPSDGSASSGSDSSGSGSAAGESNDAPTAAGSASGTETGSPTATDTAAEKSGTAGT
FT                   ATGAQTTGTASAGTANGAAATGTQTTGTATGSAPEQPTATTTPTGTTEAAPTTAVAPAT
FT                   TQAGTAAPSAAVVPSATAPSATASSEPSPSGASTSATATPKTATGQSDAQQPTVAPSAS
FT                   PRTDTASPGGDTTVPAAPSSPFVQLARDIGGALGGLIGTGTGGLVGVVGGADFATPART
FT                   LGSSIGSAIAAVAAGAAEGAASELLGWNHGLDLIGGGLGIAGATVKGAATELGRSLPGL
FT                   GGAVLTSAEQVVVPLSKTVAGATGTAVGGAIGTSLAAVASAAATATGVGVVLVPFLAAG
FT                   LPYAGARIGGSIGGVVGDVVGDALTGGFRGAAAGGGIGGIIGGAYDSATTGTPLLAALR
FT                   ASAEAGLQGAASAGPAGAVVGAATGFPSLGAAIGELIGKVGASPFDVPGLPRIVGPTAE
FT                   LLGRTIGGGIGGAANLAIGTIGGLIGVTLGKDK"
     atgaagctga agtcgattcg tagtggtgcg ctgacgtcgg tactcgccgt cgccaccgtc        60
     gtgggcgtcg tcggtgccca actcgcagta ccgccgaccg cggagcggtc gtcgccgggt       120
     gtcgagtacg tgctcacggc cggcgatccg tcggacggtt cggcctcgtc cggatctgat       180
     tcgtccggat ccggctctgc cgcaggggag tcgaacgacg cgcccaccgc tgcgggttca       240
     gcgagcggca ccgagaccgg atcgcccacg gcgacggata ccgcggcgga gaagtccggc       300
     accgccggga ccgcgaccgg tgcgcagacc accgggaccg cgtcggccgg gactgcgaac       360
     ggcgctgccg cgaccggaac ccagaccacc gggaccgcga ccgggtccgc cccggagcag       420
     cccactgcga cgaccacgcc gaccggcacc accgaggccg cgccgacgac cgctgtagcg       480
     cccgccacga cgcaggcggg aaccgccgcg cccagcgcgg cggtcgtacc gtccgccacc       540
     gcgccgtcgg ccacggcgtc gtccgaaccc tcaccgtcgg gcgccagcac gtcggcgacc       600
     gcgaccccga agaccgcgac aggacagtcg gatgcgcagc agccgacggt cgcaccgtcc       660
     gcctcgccgc gcaccgatac cgcctcgccg ggcggcgaca cgaccgtgcc cgccgcaccg       720
     tcgagcccgt tcgtgcagct cgcccgggac atcggcggcg ccctcggcgg cctcatcggc       780
     accggcaccg gtggcctcgt cggcgtggtc ggcggcgctg atttcgccac gcccgcgcga       840
     accctgggct cgtcgatcgg ctccgcgatc gccgcggtcg ccgctggtgc cgccgagggg       900
     gccgcgagcg agctgctggg ctggaaccac ggactggatc tgatcggtgg tggcctcggg       960
     atcgccggtg ccacggtcaa gggagccgcg accgagctcg ggcgtagcct tcccggcctc      1020
     ggcggtgccg tcctcacctc ggcggagcaa gtcgtggtcc cgctgtccaa gacagtcgcc      1080
     ggtgccacgg gcacggcggt cggaggggcg atcggcacgt ccctcgcggc cgtggcttcc      1140
     gcggcggcca ccgccaccgg tgtcggagtg gtcctcgtcc ccttcctcgc tgcgggtctg      1200
     ccgtacgccg gcgctcggat cggcggctcg atcggcggcg tcgtcggcga tgtggtcgga      1260
     gacgcgctca ccggcggttt ccggggtgcc gcggcaggcg gaggcatcgg cgggatcatc      1320
     ggcggagctt acgattccgc gaccacgggc actccgctgc tcgccgcgct gcgagccagt      1380
     gccgaggccg ggctccaggg cgccgcgagc gccggtccgg cgggcgccgt ggtcggtgcc      1440
     gcgaccggat tccccagtct cggcgcggcg atcggtgagc tgatcggcaa ggtgggagcc      1500
     tccccgttcg acgtgccggg cctgccccgg atcgtcggac cgaccgccga actcctcggg      1560
     cgcacgatcg gcggtggcat cggcggcgcg gcgaacctcg cgatcggcac catcggcgga      1620
     ctcatcggag tcacgctcgg caaggacaag tag                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page