(data stored in ACNUC1104 zone)

EMBL: CP001966.PE506

CP001966.PE506       Location/Qualifiers
FT   CDS_pept        549109..549738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0519"
FT                   /product="Lipoprotein LpqT, predicted"
FT                   /note="PFAM: Lipoprotein LpqT, predicted; KEGG:
FT                   mjl:Mjls_5766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77160"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:D5US93"
FT                   /inference="protein motif:PFAM:PF10738"
FT                   /protein_id="ADG77160.1"
FT                   /translation="MRRTLFALLTTAAVLVAAGCSGSSDEAPATTTTAATDMTLDEYLK
FT                   SHGVAVVAQTAADLKGVRIAVQQPPNWFVDSAFQLPNTFAVIADTRATSEGFTPNATVL
FT                   VHRLTGDIDPAEAVRRGPVDTTRYPGFRQDSVQIGTRDGDPSSTIRGSYDDGKGRRLAV
FT                   SSTYVIHSGAQQRLAVQLLVTTTEKQAQTLRGDVQTLVEGLKITDV"
     gtgcggcgca cgctcttcgc actgctcacc acggctgcgg tgctcgtcgc cgccggatgt        60
     tcggggtcga gcgacgaggc cccggctacg accaccacgg ccgctaccga tatgacgctc       120
     gatgaatacc tcaagtcgca cggcgtcgcc gtcgtcgcgc agacggcggc agacctcaaa       180
     ggcgtccgca tcgctgtgca gcagccaccg aactggttcg tcgacagcgc gttccagctg       240
     cccaacacgt tcgcggtgat cgccgatacc cgtgccacca gcgaaggatt cacgccgaac       300
     gcaacggtcc tcgtgcaccg gctcacgggt gatatcgacc ccgccgaagc cgtccgccgg       360
     ggaccggtcg ataccacccg ctatcccgga ttccgccagg actccgtgca gatcggtacc       420
     cgcgacggcg atccgtcgtc gacgatccgg ggcagttacg acgacggcaa aggtcgccga       480
     ctcgcggtct cctcgaccta cgtgatccac tccggtgcgc agcagcgcct cgctgttcag       540
     ctcctggtga ccacgacgga gaagcaggcg cagacgctgc gtggcgacgt ccagaccctc       600
     gtggagggcc tgaagatcac cgacgtgtaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page