(data stored in ACNUC1104 zone)

EMBL: CP001966.PE507

CP001966.PE507       Location/Qualifiers
FT   CDS_pept        549786..550460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0520"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cai:Caci_5788 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77161"
FT                   /db_xref="GOA:D5US94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5US94"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG77161.1"
FT                   /translation="MRVLVVEDELFLAEAVRDGLRLEAIAADIAGDGDTALEMLSVNSY
FT                   DIAVLDRDIPGPSGDEIAANIVASGTGMPILMLTAADRLDDKESGFELGADDYLTKPFE
FT                   LRELVLRLRALDRRRAHSRPPVREIAGLRLDPFRREVFRNGKYVALTRKQFAVLEVLVA
FT                   AEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIVATVPGVGYRIDAGAC
FT                   DD"
     atgcgtgtgc tggtcgtcga agacgagttg ttcctggcgg aggcggtgcg tgatggccta        60
     cggctggaag ccatcgcggc cgacatcgcc ggcgacggcg ataccgcgct cgaaatgctc       120
     agtgtgaaca gctacgacat cgcggtgctc gaccgcgata tcccggggcc gtcgggcgac       180
     gagatcgccg ccaacatcgt cgcctcgggc acgggcatgc cgatcctcat gttgaccgcc       240
     gccgaccgcc tcgacgacaa ggagtccggg ttcgagctgg gtgccgacga ctacctcacc       300
     aaaccgttcg agctgaggga actggtgctg cgattgcgcg ccctggaccg ccgacgcgcc       360
     cacagtcggc ctccggtgcg ggagatcgcc ggactgcgcc tggatccgtt ccggcgcgag       420
     gtgttccgca acggcaagta cgtggccctg acccgcaagc agttcgcggt gctggaggtg       480
     ctggtggccg cggagggcgg cgtggtcagc gccgaggaac tgctcgaacg ggcctgggac       540
     gagaacgccg atccgttcac caatgccgtc cggatcaccg tgtcggcgct ccgcaagcgc       600
     ctcggggagc cgggaatcgt ggcgacggtg ccgggggtcg gctatcggat cgacgcaggg       660
     gcctgtgatg actag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page