(data stored in ACNUC1104 zone)

EMBL: CP001966.PE508

CP001966.PE508       Location/Qualifiers
FT   CDS_pept        550453..551580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0521"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: fre:Franean1_7134 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77162"
FT                   /db_xref="GOA:D5US95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5US95"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG77162.1"
FT                   /translation="MTRPPGLSARLKLTLSYAGFLMVAGGLLLAVVWVFLLRYVPEVIA
FT                   VPDLGPREPGSGAGPQLMGIPNRADLQAAFAPKATLVLGLLLIFGLVGGWLLAGRMLAP
FT                   LNRITHATRLAAEGSLAHRIHLEGRADEFRELADAFDAMLARLEAHVAEQQRFAANASH
FT                   ELRTPLAITQTLLDVARSDPERDDDELVSRLQFVNARAIDLTEALLLLSRADRRSFTRE
FT                   SVDLSLIAEEAVETLLPLAEGRGVVLEAVGGLTPTTGSPALIQQVATNLVHNAIVHNLP
FT                   GGGTVRVRTETVADGAQLTVENTGAPLSPQVVATLTEPFQRGTGRISGGHAGVGLGLAI
FT                   VDRIVRAHDGALTLTPRPDGGLRVTVRLPAATGSP"
     atgactaggc cgccgggact gagtgcccgg ctcaaactca ccctcagcta cgccggattc        60
     ctgatggtgg cgggtggcct gctgctcgcc gtcgtgtggg tgttcctcct gcggtacgtg       120
     cccgaagtca tcgccgtacc cgatctcggc ccgcgggaac ccggctccgg tgcgggaccg       180
     cagctcatgg gtatccccaa ccgcgcagac ctgcaggccg ccttcgcgcc caaggcgacg       240
     ttggtgctgg gtctgctcct gatcttcgga ctggtcggcg gctggttgct ggccggccgg       300
     atgttggctc cgctcaaccg gatcacccat gccacccgac tcgctgcgga gggctcgctc       360
     gctcatcgca ttcatctaga gggccgggcc gacgagttcc gcgagctcgc cgacgccttc       420
     gacgccatgc tcgcccggct ggaggcgcac gtggccgaac aacaacgctt cgccgccaac       480
     gcatctcacg aactacgaac cccgttggcg atcacccaga ccttgctcga cgtggcgcgc       540
     agcgatcccg agcgcgacga cgacgagctg gtcagccgac tgcaattcgt gaacgcgagg       600
     gccatcgatc tcaccgaggc tctgctcctg ctcagccgcg ccgatcgtcg ctcgttcacc       660
     cgtgaatccg tcgatttgtc gctgatcgcg gaggaggccg tcgagaccct gctcccgctc       720
     gccgaagggc ggggtgtcgt gctcgaggcc gtcggtggac tcacccccac caccggctcc       780
     ccggccctca tccagcaggt tgccacgaac ctggtgcaca acgcgatcgt gcacaatctg       840
     ccgggcggcg gtaccgtgcg cgtgcgtacc gagaccgtcg ccgacggtgc gcagctcacc       900
     gtcgagaaca cgggcgctcc gctgagcccg caggtggtgg ccacgctcac cgagcccttc       960
     cagcgcggca ccggacggat cagcggcggc cacgccgggg tcggtctcgg tctggcgatc      1020
     gtggaccgga tcgtccgcgc gcacgacggt gcgctcaccc tcacgccccg gcccgacggg      1080
     ggcctgcgcg tcacggtgcg gttgcccgcc gcgaccggat caccgtga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page