(data stored in ACNUC1104 zone)

EMBL: CP001966.PE509

CP001966.PE509       Location/Qualifiers
FT   CDS_pept        complement(551638..552270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0522"
FT                   /product="D-Ala-D-Ala dipeptidase"
FT                   /EC_number="3.4.13.22"
FT                   /note="KEGG: cai:Caci_5792 peptidase M15D VanX D-ala-D-ala
FT                   dipeptidase; PFAM: peptidase M15D vanX D-ala-D-ala
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77163"
FT                   /db_xref="GOA:D5US96"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5US96"
FT                   /inference="protein motif:PRIAM:3.4.13.22"
FT                   /protein_id="ADG77163.1"
FT                   /translation="MNTDFVYVDEHVPGVRWDAKYATWDNFTGKPVDGYLANRIVGTRV
FT                   LCAGLRLAQRHAATLGYGLLLWDGYRPQRAVDRFVAWSRQPENGRTKQRHYPNIARADM
FT                   FELGYVATRSGHSRGSTVDLTLYHLDSGDLADMGGDHDLMDPVSHHGAPGIGEPAARNR
FT                   ARLATIMEDAGFLRYDSEWWHYTLHDEPFPTTYFDFPITLAAGSRAA"
     atgaacaccg acttcgtcta cgtcgacgag cacgtcccgg gagttcgctg ggacgcgaaa        60
     tacgccacct gggacaactt caccggcaag cccgtggacg gctacctggc caaccggatc       120
     gtgggcaccc gcgttctgtg cgccggcctc cgcctggcgc agcggcacgc agccaccctg       180
     ggatacggat tgctgctgtg ggacgggtac cggccgcagc gcgccgtcga ccggttcgtg       240
     gcctggtccc gacagccgga gaacggcagg accaagcagc ggcactaccc gaacatcgcc       300
     cgcgccgaca tgttcgagct cggctatgtg gccacccgtt ccggacacag ccggggcagc       360
     accgtcgatc tcaccctgta ccacctggat tccggcgacc tcgccgatat gggcggtgac       420
     cacgacctga tggatccggt ctcgcaccac ggtgcgcccg gcatcggcga gcccgcggcc       480
     cgcaaccgcg cccggctggc cacgatcatg gaggacgctg gatttctccg ctacgacagt       540
     gaatggtggc actacacgct gcacgacgaa cccttcccca ccacctactt cgacttcccg       600
     atcactcttg cggcgggcag ccgcgccgcg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page