(data stored in ACNUC1104 zone)

EMBL: CP001966.PE512

CP001966.PE512       Location/Qualifiers
FT   CDS_pept        complement(554366..555316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0525"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: kse:Ksed_20450
FT                   sugar kinase, ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77166"
FT                   /db_xref="GOA:D5US99"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5US99"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADG77166.1"
FT                   /translation="MTDRTLCLGEALVDVVLRDGAEPVEHVGGSLFNVACGLAALGDPA
FT                   SILSWWGRDERGARITGAAAGAGVEIVAGTEDAPATPLAYAHLDAEGRASYEFDLQWRV
FT                   PETGDLERYGHLHTGSFAATLGPGADGVRDVAARIRDHATVSYDPNIRPALMGTPAEVL
FT                   PRITELIGLADVVKASDEDISWLHPGEPVEDVMRRWVAAGPALVVVTRGPWGAYALLAG
FT                   NRDMLHVDQLTVEVADTVGAGDSFMAGLISGLLDAGYLGSRYAARRLRGARWSDVQPAL
FT                   HRAVITSALTVSRAGAYGPSMTEVETVRARDTTLR"
     atgaccgacc ggaccctgtg tctcggcgag gcactcgtcg acgtggttct gcgcgacggt        60
     gccgagcccg tcgagcacgt cggcggcagc ctgttcaacg tggcgtgcgg gctggcagca       120
     ctgggggatc cggcgtcgat cctgtcgtgg tggggccggg acgaacgggg cgctcgcatc       180
     accggcgcgg cagccggagc gggcgtcgag atcgtcgccg ggaccgagga tgcccccgcc       240
     actcccctgg cgtatgcgca cctcgacgcc gagggccgcg cgagctatga attcgacctg       300
     cagtggcgag tgcccgagac cggcgacctg gagcggtacg ggcacctgca caccggcagt       360
     ttcgcggcca cgctcgggcc cggcgccgac ggtgtgcgcg atgtggccgc ccggatccgc       420
     gatcacgcca ccgtgtccta cgacccgaac atccggcccg ccctcatggg aaccccggct       480
     gaggtactgc cgcgcatcac cgagctgatc gggctcgccg atgtggtcaa ggccagcgac       540
     gaggacatct cctggctgca tccgggggaa ccggtcgaag acgtcatgcg ccggtgggtc       600
     gcggcgggcc cggcgctcgt ggtggtcacc cgcgggccat ggggcgcgta cgcgctgctc       660
     gccggaaacc gggacatgct gcatgtggac cagttgaccg tcgaggtcgc cgatacggtg       720
     ggcgccggtg actccttcat ggcgggactg atctccggac tgctcgacgc cggctacctg       780
     ggctcgcggt acgccgctcg gcggctacgc ggcgcacgat ggagcgatgt acaacccgcg       840
     ctgcaccggg ccgtgatcac ctcggcgctc acggtgagcc gggcgggcgc ctacggcccc       900
     tcgatgaccg aggtcgagac ggtacgcgcg cgggacacca ccctgcgctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page