(data stored in ACNUC1104 zone)

EMBL: CP001966.PE521

CP001966.PE521       Location/Qualifiers
FT   CDS_pept        564156..564623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77175"
FT                   /db_xref="GOA:D5USA8"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA8"
FT                   /inference="similar to AA sequence:KEGG:Mvan_0686"
FT                   /protein_id="ADG77175.1"
FT                   /translation="MTADKDTPDQGDARGTTATPFLIALVIAVIAIGGILTWNFIRPSE
FT                   QRVPDSGQISQTVGQYYGALNHGRYADLVANTCAKDRSAPDFPQEAGFADARKAAVERE
FT                   GDATLDENGIKNVQVNGDSATADLVIKYSKAPEKTEQAKFVREDGKWKKCS"
     gtgaccgcag acaaggacac gccggaccag ggcgacgcac ggggtaccac cgcgactcct        60
     ttcctgatcg cgctggtcat cgcggtgatc gccatcggcg gcattctcac ctggaacttc       120
     atccgcccgt ccgaacagcg ggttcccgat tccggacaga tcagtcagac cgtgggccag       180
     tactacggcg cgctcaacca cggccggtac gccgatctgg tcgccaatac ctgcgccaag       240
     gatcgctccg ccccggactt cccgcaggaa gccggcttcg ccgacgcccg caaggccgcc       300
     gtcgagcgcg agggtgatgc cacgctggac gagaacggca ttaagaacgt gcaggtcaac       360
     ggcgacagcg ccaccgcaga cctggtcatc aagtacagca aggcgcccga gaagaccgaa       420
     caggccaagt tcgtccgcga ggacggcaag tggaagaagt gctcgtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page