(data stored in ACNUC1104 zone)

EMBL: CP001966.PE522

CP001966.PE522       Location/Qualifiers
FT   CDS_pept        564605..565033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0535"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: rop:ROP_19530
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77176"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA9"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADG77176.1"
FT                   /translation="MEEVLVTYAGDITPAQAWQLLHDDPNAVLVDCRTEAEWNYVGIPD
FT                   LTVLRRAVVLVEWQTYPDGALNATFVDELRRKGVTDDAPVAFLCRSGHRSIGAAEAATA
FT                   AGIQRAFNVLDGFEGGLDAEGHRGAVGWRAEGLPWRQF"
     gtggaagaag tgctcgtgac ctacgcaggt gacatcacgc cggctcaagc ctggcagctg        60
     ctgcacgacg atccgaacgc cgtcctcgtc gactgccgca ccgaggccga gtggaactac       120
     gtcggcatcc cggacctcac ggtgctacgc cgcgccgtgg tgctcgtcga atggcagacc       180
     tatcccgacg gtgcgctgaa cgcgactttc gtcgacgagc tccgccgcaa gggcgtcacc       240
     gacgatgcgc ccgtggcctt cctgtgccgc tccgggcacc ggtcgatcgg cgccgcagag       300
     gcggccacgg cggcgggcat acagcgtgcc ttcaatgtgc tcgacggttt cgagggcggc       360
     ctcgacgccg aagggcaccg cggggccgtg ggctggcggg ccgaagggct cccctggcgg       420
     cagttctag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page