(data stored in ACNUC1104 zone)

EMBL: CP001966.PE528

CP001966.PE528       Location/Qualifiers
FT   CDS_pept        complement(569593..570171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0541"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rer:pREL1_0102
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77182"
FT                   /db_xref="GOA:D5USB5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77182.1"
FT                   /translation="MPRTVDHGERRSELTDAVARIAARDGLQAVTMRAVAAEAGVSLRL
FT                   VQYYFENKHGLLIGAMRRLEEQSNARWRARLSNTADPRAMLHAFISEALPTDPESTDFY
FT                   RVSAAFGELARTDTELAAEPLAGGLTRLRSTVLDTFRAADLPPDADPEAETDALISLCN
FT                   GLSTAVLLGHHTADRAVAIASYHLDRVFR"
     gtgccgcgca ccgtcgacca tggcgaacga cgctcggagc tgaccgacgc cgtggctcgc        60
     atcgctgcac gcgacggcct gcaggccgtg acgatgcgag cggtcgcggc ggaggcggga       120
     gtgtcgctgc ggctcgtgca gtactacttt gagaacaagc acgggttgct gatcggcgcc       180
     atgcggcgac tggaggagca gtcgaacgcc cgctggcgtg cacggctgtc gaataccgcc       240
     gatccgcgag cgatgttgca cgccttcata tccgaagccc taccaaccga tccggagagc       300
     acagacttct atcgggtcag cgccgcattc ggcgaactgg cgcggacgga tacggaactc       360
     gccgccgaac ccctcgctgg cgggctcacg cgactgaggt cgacggttct cgacaccttt       420
     cgcgccgccg acctcccgcc cgatgccgac ccggaggcag agaccgacgc gctgatctcc       480
     ctgtgcaacg gcctcagcac cgcagtgcta ctcggccatc acaccgccga ccgggccgtc       540
     gcgatcgcga gctatcacct cgaccgtgta ttccgctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page