(data stored in ACNUC1104 zone)

EMBL: CP001966.PE53

CP001966.PE53        Location/Qualifiers
FT   CDS_pept        complement(54737..55291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0053"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase; KEGG:
FT                   msm:MSMEG_5977 dTDP-4-dehydrorhamnose 3,5- epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76707"
FT                   /db_xref="GOA:D5UPT9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT9"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ADG76707.1"
FT                   /translation="MRIEATDLSDVVLLVPEPHRDQRGLFTRTFDAEEFDAHLGVPGAS
FT                   ASFVQDSQSRSHGGVVRGLHGRSGRGEAKLVRCAHGAVLDVLVDIRPDSPTFGRHASFR
FT                   LDDENFHHLYVPPGFLHGFQALTPVADVCYRIDRPHDPNEDLGVVYNDPDLAISWPLPV
FT                   TVVSSREAAAGSWSELQHGLR"
     atgcgcatcg aggcgaccga tctttccgac gtggtgttgc tcgtccccga gccccaccgc        60
     gaccagcgcg gcctgttcac ccggaccttc gatgccgagg agttcgacgc gcacctcggc       120
     gtgccggggg cgtcggcgtc gttcgtccag gattcgcaat cgcgctcgca cggcggtgtg       180
     gtgcgcggtc tgcacggccg gtccggccgg ggcgaagcca agctggtgcg atgtgcgcac       240
     ggtgccgtcc tcgacgtgct cgtcgacatc cggcccgatt caccgacgtt cgggcggcac       300
     gccagcttcc gcttggacga cgagaacttc caccacctgt acgtgccgcc cgggttcctg       360
     cacgggttcc aggcactgac gcccgtcgcc gacgtctgct accggatcga ccgcccgcac       420
     gatccgaatg aggacctcgg ggttgtttac aacgaccccg atttggctat ttcatggccg       480
     ctgcctgtga cggtcgtctc atctcgggaa gcagcggccg ggtcctggtc cgagctccag       540
     cacggtctgc gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page