(data stored in ACNUC1104 zone)

EMBL: CP001966.PE535

CP001966.PE535       Location/Qualifiers
FT   CDS_pept        576991..577464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0549"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: sen:SACE_0389 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77189"
FT                   /db_xref="GOA:D5USC2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG77189.1"
FT                   /translation="MTDDERAERIEDLVRVIADLTRLKERHAAMTRHAVAPDGVELAAY
FT                   SALFALVKDGPMRSSVLAEQIHTDPSTASRYVTTLTNQGYAERTPDPSDRRAALVAATQ
FT                   AGRDKVAFIREQRNIRLRPLLQEWSDEEIEQFVKLGSRALDQFEQALRLLRED"
     atgaccgacg acgaacgggc ggagcggatc gaggacctgg tccgcgtgat cgccgacctc        60
     acccggttga aggagcgaca cgccgcgatg acccggcatg ccgtcgcgcc cgacggtgtg       120
     gagctggccg cgtactcggc actgttcgcc ctggtgaagg acgggcccat gcgctcctcg       180
     gtgctcgcgg agcagatcca caccgacccg tccacggcga gccggtacgt gaccaccctg       240
     accaaccagg gctacgccga acgcaccccc gatccgtccg accgccgcgc ggctctcgtc       300
     gccgcgaccc aggccggccg cgacaaggtg gcgttcatcc gcgaacagcg caacatccgg       360
     ctgcgcccgc tcctgcagga gtggagcgac gaggagatcg agcagttcgt gaaactgggc       420
     agccgtgccc tcgaccagtt cgagcaggcc ctgcggctgc tccgggagga ttag             474
//

If you have problems or comments...

PBIL Back to PBIL home page