(data stored in ACNUC1104 zone)

EMBL: CP001966.PE538

CP001966.PE538       Location/Qualifiers
FT   CDS_pept        complement(581437..581937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0552"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: rer:RER_06170 inorganic pyrophosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77192"
FT                   /db_xref="GOA:D5USC5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC5"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADG77192.1"
FT                   /translation="MEFEVTVEIAKGSRNKYEVDHKSGRLKLDRYLYTSFGYPTDYGYI
FT                   EDTLGEDGDPLDALVLLPESVIPGSLVDCRAIGMFKMEDEKGGDDKVLVVPAGDPRWDA
FT                   IQDLEHIDKFELDAIEHFFVHYKDLEPGKFVKGSTWVGKAEAEKEIAASIARAEAAAEG
FT                   IDS"
     gtggaattcg aggtcaccgt cgagatcgct aagggctcgc ggaacaagta cgaggtcgat        60
     cacaagtcgg gtcgtctcaa gctggaccgc tacctgtaca cgtcgttcgg ctaccccacc       120
     gactacggct acatcgagga caccctgggc gaggacggcg atccgctcga tgcgctggtc       180
     ctgctgccgg aatcggtgat ccccgggtcg ctcgtggact gccgggccat cggcatgttc       240
     aagatggagg acgagaaggg cggcgacgac aaggtgctcg tggtgcccgc cggcgatccg       300
     cgctgggacg ccatccagga tctggagcac atcgacaagt tcgagctgga tgcgatcgag       360
     cacttcttcg tgcactacaa ggatctcgag cccggcaagt tcgtgaaggg ttcgacctgg       420
     gtcggaaagg ccgaggcgga gaaggagatc gccgcgtcga tcgcccgcgc cgaggcggcc       480
     gccgagggca tcgacagcta g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page