(data stored in ACNUC1104 zone)

EMBL: CP001966.PE54

CP001966.PE54        Location/Qualifiers
FT   CDS_pept        55306..56325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0054"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bbt:BBta_7048 putative O-antigen export system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76708"
FT                   /db_xref="GOA:D5UPU0"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU0"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG76708.1"
FT                   /translation="MTASSPGDTVYRIVADSWYAPHLRGAVALDDLLPRPVRSAAARSG
FT                   LLRGLLLAAAGLRADAVVTTNPSPGAAICLALYGLLGRRRVVLLEYIVHPPSGRFGRLR
FT                   FTVLRKLLLRRALLRAQVLTDAEVPAYAALHGVGPDRFEVVRWPARFDETPAPALRAGR
FT                   VVVASGRRTDWDTFLRAADGADWDVRVVCTGADLAAVQSLAPPSATVLHDISADENQAV
FT                   VNQATVYVIPVPETGASIGQIRVMNAGQAGVPVVASDVSGFAGYLDQEVAVLVPPGDPA
FT                   ALRAAVDALLDDPARREGLRSAARARGGTMDEYLTRIDELAHRGAGPEPVTDGVERIS"
     atgaccgctt cctcgccggg cgacaccgtg taccggatcg tcgccgattc ctggtacgca        60
     ccgcacctgc gcggcgcggt cgcgctcgac gatctgctcc cgcggccggt gcggagcgcc       120
     gcagcccgca gtgggctgct gcgcgggctg ctgctggcgg cggccggact acgtgccgac       180
     gcggtcgtga cgacgaatcc gagccccggc gcagcgatct gcctggccct gtacggactg       240
     ctcgggcggc ggcgtgtggt gctgctcgaa tacatcgtgc atccgccttc gggacggttc       300
     ggccgtctgc gattcaccgt gttgcgcaag ctgctgctgc ggcgtgcgct gctgcgggcc       360
     caggtcctca ccgatgccga ggttccggcc tacgccgctc tgcacggtgt cggcccggac       420
     cgcttcgagg tggtccggtg gcccgcccgg ttcgacgaga cgccggcgcc tgcgctgcgt       480
     gcgggccggg tggtcgtggc ctcgggccgc agaaccgact gggacacctt cctgcgggcg       540
     gccgacggcg ccgactggga cgtccgggtg gtgtgcaccg gagccgacct cgccgcagtg       600
     cagagccttg cgccaccgtc agccactgtg ctgcacgata tttcggcgga tgagaaccag       660
     gccgtcgtga accaggccac cgtgtacgtg attccggtac cggagacggg cgcgagtatc       720
     gggcagatcc gcgtgatgaa cgccggtcag gcgggtgtgc ccgtggtggc ctccgatgtc       780
     tcgggattcg cgggctacct cgaccaggag gtggcggttc tggtgccgcc cggggatccc       840
     gccgcgctgc gcgccgccgt ggacgcgctg ctcgacgatc cggcgcgccg ggaggggttg       900
     cgcagcgctg cgcgggcccg cgggggcacc atggacgagt atctgacccg gatcgacgag       960
     ctggcccacc gcggagccgg cccggagccg gtcaccgacg gcgtggagag gatcagctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page