(data stored in ACNUC1104 zone)

EMBL: CP001966.PE540

CP001966.PE540       Location/Qualifiers
FT   CDS_pept        583428..584465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43180 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Protein of unknown
FT                   function DUF2342"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77194"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC7"
FT                   /inference="protein motif:TFAM:TIGR03624"
FT                   /protein_id="ADG77194.1"
FT                   /translation="MATRRHRSPQVDWSLAAAAARRLAGGGPATTAYTRDRAAAQLIGF
FT                   AAEAERHVRDVTGLATGARIPAARTVDRREWVDAAARSMAALLDGDHSGRPGIGARIAG
FT                   LQAGGMLGFVSGSILGQYDPFGTSDGELLLVVPNVLRVERALGLDPDDFRMWVCLHEVT
FT                   HRVQFAANPWLRDHMRDNVAALTGDGDSGTVADLLHRVNAALRGGKRHDGVIGLLQIAA
FT                   PAEQFAAIENLLILGTLLEGHADHVMDAAGPTVVPTVATIRAAFDRRRASPANPLQRVL
FT                   RALLGVDAKIAQYVRGKKFVDAVVADVGMDRFNTVWSGPDTLPRDEEFDEPARWMARVL
FT                   GAPAP"
     atggccaccc gccgtcaccg cagcccgcag gtcgactggt cgctcgcggc cgccgccgcg        60
     cgacggctcg ccggtggtgg accggcgacc accgcgtaca cccgcgaccg cgccgcagcc       120
     cagctcatcg gcttcgcagc cgaagccgaa cggcacgtgc gtgacgtcac cggcctggcc       180
     accggtgcgc ggataccggc ggcgcgcacc gtcgaccgcc gggagtgggt cgatgcggcg       240
     gcgcggtcca tggccgctct gctcgacggc gatcacagcg gccgccccgg tatcggagcc       300
     cggatcgccg gactgcaggc cggcggcatg ctcgggttcg tttccggatc gattctcgga       360
     caatacgatc cgttcggcac ctccgacggt gagctgcttc tcgtcgtgcc caacgtgctg       420
     cgtgtcgaac gcgccctggg tctcgacccc gatgacttcc ggatgtgggt gtgtctgcac       480
     gaggtgaccc atcgggtgca gttcgccgcc aacccgtggc tgcgggatca catgcgggac       540
     aacgttgccg ctctgaccgg cgacggagac agcggcacag tcgccgatct gctgcaccgg       600
     gtgaacgccg cactgcgcgg tggcaaacgg cacgacgggg tgatcgggct actccagatc       660
     gccgctcccg cagagcagtt cgccgccatc gagaacctcc tgatcctggg aaccctgttg       720
     gaagggcacg ccgaccacgt gatggatgcc gccggaccga cggtggtgcc cactgtcgcc       780
     accatccgtg cggccttcga ccggcgccgc gcctcgcccg cgaatccgct gcagcgggtg       840
     ctgcgtgccc tcctcggcgt ggatgcgaag atcgcgcagt acgtgcgcgg taagaagttc       900
     gtcgatgccg tggtggccga cgtgggcatg gaccggttca acaccgtatg gtccggtccc       960
     gacaccctgc cccgtgatga ggagttcgac gaacccgccc ggtggatggc ccgcgtcctc      1020
     ggcgcaccgg ccccgtga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page