(data stored in ACNUC1104 zone)

EMBL: CP001966.PE541

CP001966.PE541       Location/Qualifiers
FT   CDS_pept        584462..585400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0555"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: mgi:Mflv_1411 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77195"
FT                   /db_xref="GOA:D5USC8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC8"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADG77195.1"
FT                   /translation="MSRPGPAALQIRRAVQHWAARYGAPSTVAVAVSGGPDSLALLAGA
FT                   VAAGLEPVALVVDHGLQPDSAATAARAAGQARSAGARRADVLTVIVDAAGGPEAAARTA
FT                   RYRALDAHRDGLPVLLGHTLDDQAETVLLGLGRGSGARSLAGMAAWAEPYGRPLLGVRR
FT                   AVTRQACAELGLDPWDDPHNTDARYTRVRLRHEVLPLLEEVLGGGVAQALARTAASLRD
FT                   DNDALDALTPAPSGDELPVADIEHLPPALRRRALRAWLAGRGARALTAAHLAAVDALVS
FT                   DWHGQGPAAVPGGSAGRRLQVHRTGGILSAW"
     gtgagccggc ccggccccgc ggccctgcag atccgccgcg ccgtgcagca ctgggcggca        60
     cggtacggcg caccgtcgac ggtggcggtc gccgtgtccg gcggtccgga ctccctggcc       120
     ctgctcgccg gagccgtcgc cgcggggctg gagccggtcg cgctggtcgt cgaccacggt       180
     ctgcagccgg actcggcggc caccgccgct cgcgccgccg gccaggcccg cagcgcaggg       240
     gctcgccgcg ccgacgtcct gaccgtgatc gtcgacgccg ccggaggacc ggaggccgcg       300
     gcccggaccg cccgctaccg cgcactcgac gcccaccgtg acggcctgcc cgtgctgctc       360
     gggcacaccc tcgacgatca ggccgaaacc gtgctgctcg gtctcggtcg gggctctggc       420
     gcccgctcgc tcgccggcat ggcggcctgg gccgagccct acgggcggcc cctgctcggc       480
     gtgcgtcgcg ccgtcacccg ccaggcgtgc gccgaactcg gcctcgaccc ctgggacgac       540
     ccccacaaca ccgatgcgcg ttacacccgg gtccggctgc gccacgaggt gcttccgctc       600
     ctggaagagg ttctcggcgg gggagtggcg caggccctgg cccgcactgc cgcgtcgctg       660
     cgtgacgaca acgacgcact cgacgctctc actcccgcgc cgtcgggcga tgagcttccg       720
     gtcgccgaca tcgaacatct gccgcccgcg ctccggcgaa gggcgttgcg cgcctggctc       780
     gccggccgcg gcgcccgcgc tctcaccgcc gcacacctcg ccgcggtcga tgccctggtc       840
     agcgactggc acggccaggg accggccgcg gtgccgggcg gaagtgcggg gcggcggctg       900
     caggtgcacc gcacaggtgg cattctgagt gcgtggtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page