(data stored in ACNUC1104 zone)

EMBL: CP001966.PE542

CP001966.PE542       Location/Qualifiers
FT   CDS_pept        585397..585963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0556"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: mjl:Mjls_5161 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77196"
FT                   /db_xref="GOA:D5USC9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC9"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADG77196.1"
FT                   /translation="MNGTGELYAGDIASVVLSEEQIKQRIAELAAQIAEEYGDRETDLL
FT                   LITVLKGAVMFVTDLARALPVPTQLEFMAVSSYGSSTSSSGVVRILKDLDRDIAGRDVL
FT                   IVEDIIDSGLTLSWLLRNLATRQPNSLEVVTLLRKPDAVRVDVDVKWVGFDIPNEFVVG
FT                   YGLDYAERYRDMPYIGILEPKVYSE"
     gtgaacggca cgggtgagtt gtacgcggga gacatcgcct cggtggtgct ctccgaggag        60
     cagatcaagc agcggattgc ggaactcgcg gcgcagatcg cggaggaata cggagaccgg       120
     gagaccgacc tcctgctgat caccgtgctc aagggcgcgg tcatgttcgt gaccgacctg       180
     gcccgggcgc taccggtgcc cacgcagctc gagttcatgg ccgtctcgag ctacggttcg       240
     tcgacgtcga gctcgggcgt ggtgcgcatc ctcaaggacc tcgaccgcga tatcgccggc       300
     cgtgatgtgc tcatcgtcga ggacatcatc gattccggtc tcacgctgag ctggctgctg       360
     cgcaacctcg cgacacggca gccgaactcg ctcgaagtgg tcacgctcct gcgtaagccc       420
     gacgccgtgc gggtggacgt cgacgtgaag tgggtcggct tcgacatccc caacgaattc       480
     gtcgtcggct acgggctcga ctacgccgag cggtaccgcg atatgcctta catcggcatc       540
     ctggagccca aggtctacag cgaatga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page