(data stored in ACNUC1104 zone)

EMBL: CP001966.PE544

CP001966.PE544       Location/Qualifiers
FT   CDS_pept        complement(587274..587711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_4969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77198"
FT                   /db_xref="GOA:D5USD1"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD1"
FT                   /inference="similar to AA sequence:KEGG:Mvan_4969"
FT                   /protein_id="ADG77198.1"
FT                   /translation="MTDPQYPQAPVAAPSPTWNSRFDFYNTYGHPSASAHGAAAFKQLS
FT                   FGERFRLTANGPAFFFGPIYFAIKGPWRKGLSLFGVAVAISALIGVIELAFDISFPAAG
FT                   FGAAIGVLYSTAANWAYYQHVAYGSTSWNPFEGVPLLRARK"
     gtgaccgatc cccagtatcc ccaggccccg gtggccgcac cgtcgcccac gtggaacagc        60
     cgcttcgact tctacaacac ctatggccat ccctccgcat cggcgcacgg ggcggccgcg       120
     ttcaagcagt tgtccttcgg ggagcggttc cggctcacgg cgaacggtcc ggcgttcttc       180
     ttcggcccga tctacttcgc gatcaaggga ccgtggcgca agggtctgag cctgttcggc       240
     gtcgccgtcg cgatcagcgc cctgatcggc gtgatcgagc tggccttcga catctcgttc       300
     cccgctgccg ggttcggcgc cgctattggc gtgctctatt ccacggccgc gaactgggcg       360
     tactaccagc acgtggccta cggcagcacc agctggaatc cgttcgaggg tgttccgctg       420
     ctgcgggccc ggaagtag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page