(data stored in ACNUC1104 zone)

EMBL: CP001966.PE548

CP001966.PE548       Location/Qualifiers
FT   CDS_pept        591742..592125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0562"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   msm:MSMEG_6102 dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77202"
FT                   /db_xref="GOA:D5USD5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD5"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADG77202.1"
FT                   /translation="MADRIELTGLRVRGNHGVFDHERRDGQEFIVDLVLWLDSRPAATS
FT                   DDLADTVDYGALAQLAHDIVAGEPRNLIETVAAEIADGIAADPRVYATEVTVHKPSAPI
FT                   PLTFADVAVVARRSRAGARGVPQ"
     atggccgacc gcatcgagct caccggactg cgggtgcgcg ggaaccacgg tgtcttcgac        60
     cacgagcgcc gcgacggcca ggaattcatc gtcgacctgg tgctgtggct cgactccagg       120
     cccgcggcga cctccgacga cctggccgac accgtcgact acggggcact ggctcagctc       180
     gcgcacgaca tcgtggcggg ggagccgcgc aacctcatcg agaccgtcgc cgctgagatc       240
     gccgacggta tcgccgccga cccgcgggtc tacgccaccg aggtcacggt gcataagccg       300
     tcggctccga tcccgctgac cttcgcggac gtggcggtcg tcgcccgtcg ctcccgcgcc       360
     ggcgctcgcg gggtgccgca gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page