(data stored in ACNUC1104 zone)

EMBL: CP001966.PE549

CP001966.PE549       Location/Qualifiers
FT   CDS_pept        592122..592610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0563"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridin
FT                   epyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropter idinepyrophosphokinase; KEGG:
FT                   rop:ROP_43270 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77203"
FT                   /db_xref="GOA:D5USD6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD6"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADG77203.1"
FT                   /translation="MTRAVLSIGANLGDAETAVRGAITALGPALVAASPLYRTPPWGGV
FT                   EQDDFINATVLADDPSRTAAGWLDFARDQEAAADRIRDVRWGPRTLDVDVIAVWDAEVP
FT                   IRSDDPELTLPHPRAHQRAFVLVPWRAVDPAAELPGHGTVDDLLAALPAGEVAEVTPL"
     gtgacccgcg cggttctctc gatcggggcc aacctcggtg atgccgagac cgcggtccgt        60
     ggcgcgatca cggcgctcgg cccggcgctg gtggcggcgt cgccgttgta tcgcaccccg       120
     ccgtggggcg gggtggagca ggacgacttc atcaacgcca ccgtgctcgc cgacgatccg       180
     tcgcggaccg ccgccggctg gttggacttc gctcgcgatc aagaggctgc cgccgaccgg       240
     atccgcgacg tgcgctgggg cccacgcacg ctggatgtgg acgtcatcgc ggtctgggac       300
     gcagaggtac cgatccgctc cgacgatccc gagctcaccc tgccgcaccc acgggcccat       360
     cagcgggcgt tcgtgctggt gccgtggcgc gcggtcgacc ccgcggccga gctacccggc       420
     catggcaccg tcgacgacct gctcgccgca ctgcccgccg gcgaggtcgc agaggtgacg       480
     ccgctgtga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page