(data stored in ACNUC1104 zone)

EMBL: CP001966.PE550

CP001966.PE550       Location/Qualifiers
FT   CDS_pept        592664..593134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77204"
FT                   /db_xref="GOA:D5USD7"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD7"
FT                   /inference="similar to AA sequence:KEGG:ROP_43280"
FT                   /protein_id="ADG77204.1"
FT                   /translation="MRSTGWIELVVIVLGVGLGTYILVKDLVPPIPIWAGAMLYGIAAA
FT                   DLWIAQLIRSRLAKGQVGMGPGRLHPIAVARAVALAKASAYLGAVSLGFFGGALAFLLT
FT                   KGSELTATHADRPGAWIGLVGAGLLLASALWLEQCCRTPDDPDEQPADTSPA"
     atgcgcagca ccgggtggat cgaactggtg gtgatcgtgc tgggcgtcgg tctcggtacg        60
     tacatcctgg tcaaggacct ggtgccgccg atcccgatct gggcgggcgc catgctctac       120
     ggcatcgccg ccgcagatct gtggatcgcg cagctcatcc gttctcggtt ggccaagggg       180
     caggtgggga tggggcccgg acgcctgcat ccgatcgccg tggcccgcgc cgtggcgctg       240
     gcgaaggcct cggcgtacct cggggccgtc tcgctgggct tcttcggtgg cgcgctcgcg       300
     ttcctgctca ccaagggcag tgagctgacc gcgactcatg ccgaccggcc cggcgcgtgg       360
     atcggcctgg tgggcgcggg gctgctgctg gcctcggcgc tgtggctcga acagtgctgc       420
     cgcacaccgg acgaccccga cgagcaaccc gccgacacct cgcccgcctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page