(data stored in ACNUC1104 zone)

EMBL: CP001966.PE551

CP001966.PE551       Location/Qualifiers
FT   CDS_pept        593236..594381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_1422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77205"
FT                   /db_xref="GOA:D5USD8"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD8"
FT                   /inference="similar to AA sequence:KEGG:Mflv_1422"
FT                   /protein_id="ADG77205.1"
FT                   /translation="MMDPGNRKRAPRRSNAGAGQWMLGAVIVLAVAGTGMWIFSDDKRW
FT                   GLLALILLVWGLVIAAFLIARNARDIRSAESKESGLKAVYELQLEREISARREYELQLE
FT                   HDLRSELRHESNEELTALKAEVLALRANLEELLGRDLGPSYTELYAAAEQRAIDAQRAK
FT                   SVFEDDDRFRAQQDFAGVPPPVPDVDSYYGAASAVNDVPDFPAAAEQPVDAPSAPNRPQ
FT                   EDTPTAVFEAVVDPQSPAAAPPVDAEPVDVEHIDHIDGDEPFVPLAPQSGYRPPFPPRR
FT                   FTPDAAQQQPPQFAQYAPPERAPQQPAPADQVHSIPTVPPFPAAEPTPAAPLQETRPED
FT                   DDVHEQDSTRGQHSSGSTVAELIARMNADTERSGGRRRKPE"
     atgatggatc ccggcaatcg gaagcgagcc ccgcgtaggt ccaacgccgg tgccgggcag        60
     tggatgctgg gtgcggtgat cgtgctggcc gtggccggta ccgggatgtg gatcttctcc       120
     gacgacaagc gctggggtct tctcgccctg atactgctgg tctggggtct ggtgatcgcc       180
     gcattcctga tcgctcgcaa cgcccgcgac atccgctcgg cggagtcgaa ggagagcggt       240
     ctcaaggcgg tctacgagct ccagctcgag cgcgagatct ccgcccggcg cgaatacgaa       300
     ctgcagctcg agcacgacct gcgctccgag ctgcggcacg agtccaatga agagctcaca       360
     gcactcaagg cagaggtgct cgcgttgcgc gccaacctcg aagagctgtt gggtcgcgac       420
     ctgggcccgt cgtacaccga gctgtacgcc gccgccgagc agcgcgcgat cgacgcccag       480
     cgcgccaagt ccgtgttcga agacgacgac cgattccgcg cgcagcagga tttcgccggc       540
     gtgccgcccc cggtgcccga cgtcgacagc tactacggcg ccgcttccgc ggtgaacgac       600
     gtcccggact tcccggcggc cgcggagcag cccgtcgacg cgccctccgc gccgaaccgg       660
     cctcaggagg acacgcccac cgcggtcttc gaggccgtcg tcgacccgca gtcgccggcc       720
     gctgcgccgc cggtcgatgc cgagccggtc gacgtcgagc acatcgacca catcgacggc       780
     gacgagccct tcgtcccgct ggccccgcag tccggctacc gcccgccctt ccctccgcgc       840
     cggttcaccc cggatgccgc gcagcagcag ccgccgcagt tcgctcagta cgccccgccg       900
     gagcgcgctc cgcagcagcc cgcgcccgcg gaccaggtgc acagcatccc caccgtgccg       960
     cccttccccg ccgccgaacc cacgcccgcg gcgccgctgc aggagacgcg gccggaggac      1020
     gacgacgtgc acgagcagga cagcacgcgc ggccagcact cctcgggcag caccgtggcc      1080
     gagctgatcg cccggatgaa cgccgacacc gagcgcagcg gcggccgccg gcgcaagccg      1140
     gagtga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page