(data stored in ACNUC1104 zone)

EMBL: CP001966.PE557

CP001966.PE557       Location/Qualifiers
FT   CDS_pept        598195..599991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0571"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: sma:SAV_4749
FT                   lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase class
FT                   1c"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77211"
FT                   /db_xref="GOA:D5USE4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE4"
FT                   /inference="protein motif:TFAM:TIGR00467"
FT                   /protein_id="ADG77211.1"
FT                   /translation="MTVAPVNAPLDDWVTRLADEAVAFAEQNDAPVKVASGISPSGPIH
FT                   LGNLREVMVPHLVADELRRRGRTVEHIISWDDFDRFRKVPTIDGVDETWEQHIGKPLTR
FT                   VPAPYGSDAANWAEHFRRELETALVELGVTYRGISQTQMYSSGAYIDQVLHAMAERQRI
FT                   DAILERYRTLDKAKKGGVTVDQPEADAEAADAASGSADEADGSGDSGYYPYKPYCSVCG
FT                   TDFTTVIGYDDESTALKYQCRCGHTETVILREHTDGKLVWKVDWPMRWAFEKITFEPSG
FT                   VDHQSPGSSFAVGKDVAPIFGWRRPLGPMYAFVGIRGMAKMSSSKGGVPTAAIALRYLE
FT                   PPLLRWLYGRKKPNQSFDVALDGELPRTYDEWDALTRKVAGDKAQPGDIAAYARAASVA
FT                   DPVEGQVRALALTPRTMPYRTLASVVDITTGDDEQTLRILGALEPDEPLTGLDVLRPRL
FT                   DKATTWVAEQMPAQERTVVRTAPDTDLLRGLTDDERAALRLLLDGSGTPAPEGLGRLED
FT                   DWTLAGITHQVYGVAKVQRGLGADQIVKGDKELGAAQRAFFVLLYRLLVGGDTGPRLPT
FT                   LLLAIGAKRVRELVASDRIQPN"
     gtgaccgtag cccctgtgaa tgcgcccctg gacgactggg tgacccgcct cgccgatgag        60
     gcggtcgcct tcgcggagca gaacgacgcc ccggtgaagg tggcatcggg tatctccccg       120
     tcggggccga tccatctcgg caacctgcgc gaggtgatgg tgccgcacct ggtggcggac       180
     gaactgcgcc gccgcggccg caccgtcgag cacatcatct cgtgggacga cttcgaccgc       240
     ttccgcaagg tccccacgat cgacggtgtc gatgagacct gggagcagca catcggtaag       300
     ccgctgaccc gggtgcccgc accgtacgga tccgacgccg ccaactgggc ggagcacttc       360
     cgccgggagt tggagacggc gctggtcgag ctgggtgtga cctaccgcgg gatcagccag       420
     acgcagatgt actcctcggg tgcctacatc gaccaggtgc tccacgccat ggccgagcgt       480
     cagcggatcg acgcgattct ggagcgctac cgaaccctgg acaaggcgaa gaagggcggc       540
     gtcacggtcg atcagcctga ggccgacgcg gaagccgccg acgccgcatc gggttccgcg       600
     gacgaggccg acgggtccgg cgattccggt tactacccgt ataagccgta ttgctccgtt       660
     tgtggcaccg atttcacgac cgtcatcgga tatgacgacg agtcgaccgc tttgaaatat       720
     cagtgtcgct gcggtcacac cgagaccgtg atcctccgcg aacacactga tggcaagctg       780
     gtgtggaagg tcgattggcc catgcgctgg gcattcgaga agatcacatt cgagccttcg       840
     ggtgtggatc atcagtcgcc cggttcttcg ttcgccgtag gtaaggatgt ggcgccgatc       900
     ttcggatggc ggcgccccct cgggccgatg tatgcattcg tcggaatccg tggaatggcg       960
     aagatgtcgt cctcgaaggg cggagtgccg accgccgcga ttgcgctgcg atacctcgag      1020
     ccgccgctgt tacgttggct gtacggacgc aagaagccca atcagtcctt cgacgtggcg      1080
     ctcgatggag aactgccgcg cacctatgac gaatgggacg ccctgacccg caaggtggcc      1140
     ggcgacaagg cacagcccgg tgacatcgcc gcctacgccc gcgccgcctc ggtcgccgat      1200
     ccggtcgagg gacaggtgcg cgcgctcgcg ctcacaccgc gcacgatgcc ctatcgcacc      1260
     ctggcgtccg ttgtcgacat caccaccggc gacgatgagc aaaccctgcg catcctcggt      1320
     gccctggaac cggatgagcc tctgaccggc ctggatgtgc tgcgcccgcg gctggacaag      1380
     gcaaccacct gggtcgccga gcagatgccg gcgcaggaac ggaccgtggt gcggaccgcg      1440
     cccgacaccg atctgctgcg cggattgacc gacgatgaac gtgccgccct gcgactactg      1500
     ctcgacggtt ccggcacccc ggccccggag gggctcggcc gcctcgagga cgattggacg      1560
     ctcgccggaa tcacgcatca ggtgtacggc gtcgccaagg tgcagcgcgg cctgggggcg      1620
     gatcagatcg tcaaggggga taaggaactc ggcgcagcgc aacgcgcatt tttcgtgctt      1680
     ctctatcggc tgttggtggg cggagacacc ggtccccgtc ttcctaccct gctgcttgcg      1740
     atcggtgcga aacgcgtacg agaactggtc gcgagcgacc ggattcaacc gaattag         1797
//

If you have problems or comments...

PBIL Back to PBIL home page