(data stored in ACNUC1104 zone)

EMBL: CP001966.PE558

CP001966.PE558       Location/Qualifiers
FT   CDS_pept        600131..600475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0572"
FT                   /product="Lsr2 protein"
FT                   /note="KEGG: msm:MSMEG_6092 Lsr2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77212"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE5"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_6092"
FT                   /protein_id="ADG77212.1"
FT                   /translation="MARKVTVTLVDDVDDTQTADETVEFGLDGVTYEIDLSAKNAAQLR
FT                   ESLDTWIASARRSGGRKRGARAASAPRGRTPIDRSQSAAIRDWARGAGLKVNDRGRISQ
FT                   DVIDAYNEAN"
     atggcgcgca aggtcaccgt tacgcttgtc gacgacgttg acgatacgca gaccgccgac        60
     gagaccgtgg aattcggtct ggacggcgtc acgtatgaaa tcgatctttc ggcgaagaac       120
     gcggcgcagc tgcgagagtc gctcgatacc tggatcgcga gtgcgcgccg cagtggtggc       180
     cgcaagcgcg gcgcccgtgc cgcgtccgcc ccgcgcggcc gcaccccgat cgaccgttcg       240
     cagagcgccg cgatccggga ctgggctcgc ggcgccggcc tgaaggtgaa cgaccgtggc       300
     cggatcagcc aggacgtgat cgacgcctac aacgaggcca actag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page