(data stored in ACNUC1104 zone)

EMBL: CP001966.PE567

CP001966.PE567       Location/Qualifiers
FT   CDS_pept        complement(609538..610887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0583"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="PFAM: flavin-containing monooxygenase FMO; KEGG:
FT                   cyc:PCC7424_4856 flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77221"
FT                   /db_xref="GOA:D5UST4"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST4"
FT                   /inference="protein motif:PFAM:PF00743"
FT                   /protein_id="ADG77221.1"
FT                   /translation="MDNRRDRVCVIGAGYVGNGVAGALKRAGVPYDQIEATDRIGGNWS
FT                   HGVYDSTHLISSKSSTQYVEFPMPADYPTFPSRAQMLAYLQSYVDHYGLTEHIEFDTEV
FT                   VDVRPVDANGMAGWFVRLASGEERRYRAVVVANGHYWERNLPQYPGEFTGTQLHSKDYK
FT                   QPADFAEGGRVLVVGAGNSASDIAVEASATFGSADISMRRGYWFIPKAMFGIPVSELDR
FT                   VWWPMPLQRAGFKVMLRLSYGDYKRYGLKRPDHKLFTRDVTVNTSLMYALQHGKVRPRP
FT                   EIERFDGATVHFTDGTSADYDTVVWATGFHTRFPMLDESMFVWENGDPLLIEHVLAPRF
FT                   ANIYLMGLVAPRSGAGRIISHGSAFLAEAIPAQAHFAEPLSDVVARWIPAHSSMLAGSA
FT                   EILGRIRLLRQALRLLVAASVLRPRTPGLRTSAPPATAPVDSTPKESIPS"
     gtggacaatc gacgtgatcg cgtctgcgtg atcggagccg gctacgtcgg caacggtgtc        60
     gcgggtgccc tgaagcgggc cggggtgccc tacgaccaga tcgaggccac tgaccggatc       120
     ggcgggaact ggtcgcacgg cgtctacgac tcgacgcacc tgatcagctc gaagtcgtcg       180
     acccagtacg tcgagttccc catgcccgcc gactacccga ccttccccag ccgggcccag       240
     atgctggcct acctgcagtc ctacgtcgac cactacggac tcacagagca catcgaattc       300
     gacaccgagg tcgtcgatgt ccggccggtc gacgcgaacg gcatggcggg ctggttcgtc       360
     cgcctcgcct ccggcgagga gcggcgctac cgcgccgtgg tggtggccaa cggccactac       420
     tgggagcgca acctgccgca gtaccccggc gagttcaccg gcacacagct gcactcgaag       480
     gactacaagc agcccgccga cttcgccgag ggcggccgag tgctcgtggt gggcgcgggc       540
     aactcggcca gtgacatcgc cgtggaggcc tcggcgacct tcggctcggc cgatatctcc       600
     atgcgccgcg gttactggtt catccccaag gccatgttcg gcatcccggt ctccgaactc       660
     gaccgcgtgt ggtggccgat gcccctgcag cgggcgggat tcaaggtcat gctgcgcctg       720
     agctacggcg actacaagcg gtacggcctc aaacggcccg accacaagct gttcacccgc       780
     gacgtcaccg tcaacacctc actgatgtac gcgctccagc acggcaaggt caggccgcga       840
     cccgaaatcg agcggttcga cggtgccacc gtgcatttca ccgacggcac ctcagcggac       900
     tacgacaccg tggtgtgggc caccggattc cacacccggt tccccatgct cgacgagtcg       960
     atgttcgtct gggagaacgg cgaccccctc ctgatcgagc acgtgctcgc gccccggttc      1020
     gccaacatct acctcatggg acttgtcgcc ccgcgttccg gggcgggccg gatcatctcg      1080
     cacggctcgg cgtttctcgc cgaggcgatc ccggcgcagg cgcacttcgc cgagccgctc      1140
     tccgatgtcg tcgcccgctg gattccggcg cactcatcga tgctcgccgg ctccgcggag      1200
     atcctcggcc gcatccgact actacgccag gcgcttcggc tgctggtagc cgcatcagtg      1260
     ctccgcccgc ggacccccgg ccttcgcacc tccgcacccc cggccaccgc tccggtcgat      1320
     tccaccccca aggagagcat cccgtcatga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page