(data stored in ACNUC1104 zone)

EMBL: CP001966.PE57

CP001966.PE57        Location/Qualifiers
FT   CDS_pept        57964..58539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0057"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: rop:ROP_39590 dTDP-6-deoxy-D-xylo-4-hexulose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76711"
FT                   /db_xref="GOA:D5UPU3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU3"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ADG76711.1"
FT                   /translation="MAMRARGLTVPGAFEFTPQQFGDDRGRFLEWFKASEFEEATGAPM
FT                   PELQQANCSVSAAGVLRGVHYTLTPPGQAKYVTCVRGAFLDVVVDLRRDSPTFGTWDTV
FT                   LLDDVDRRAVYLPAGLGHAILSLEDRSTVMYLCSVEYAPDVDRELDAFDPDLAIDWPTE
FT                   GRDGTPLTYVRSAKDEAAPSLREVFGGR"
     atggctatgc gggcacgagg gttgacggtt ccgggtgcgt tcgagttcac gccgcagcag        60
     ttcggagacg accggggccg gttcctggag tggttcaagg cctctgagtt cgaagaggcc       120
     accggtgcgc ccatgccgga gctgcagcag gcgaactgct cggtctcggc cgcgggagta       180
     ctgcgcggcg tgcactacac gctcaccccg ccggggcagg cgaagtacgt gacctgcgtg       240
     cgcggcgcct tcctcgacgt cgtggtggac ctgcgccgcg attccccgac cttcggtacc       300
     tgggacacgg tattgctcga cgatgtggac cgccgcgccg tgtacctgcc cgccggcctg       360
     ggccacgcga tcctgtcgct ggaggaccga tcgacggtga tgtacctgtg ctcggtggag       420
     tacgcaccgg acgtggatcg tgaactcgac gccttcgacc ccgatctcgc gatcgactgg       480
     cccaccgagg ggcgcgacgg gacaccgctc acctacgtcc gatcggcgaa ggacgaggcg       540
     gcaccctcgc tgcgcgaggt gttcgggggg cgatga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page