(data stored in ACNUC1104 zone)

EMBL: CP001966.PE571

CP001966.PE571       Location/Qualifiers
FT   CDS_pept        612912..613688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0587"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; PGAP1 family
FT                   protein; KEGG: mgi:Mflv_1435 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77225"
FT                   /db_xref="GOA:D5UST8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77225.1"
FT                   /translation="MFVDECVGLRDWGGHGDGRPIVLLHGLMGRGRTWRRQIPWLRRYG
FT                   RVFTFDAEFHRGTGLPVPGGDVSTERFVADVAEILTVLDQGPAVLVGHSMGGLHAWCTA
FT                   AEYPELVDALVVEDMSPEFTGQSTDTWAPWFASWPDRFATQGQCEELFGAVAGRYFYEA
FT                   FDDGVLHGDLETFRAIADHWGLRDHWDQWRAVAVPTLLIEAEFSVVPSGVGDRMVRDYA
FT                   GPDLRYVRFDGAGHLAHDDAPDRYRGAVEAFLSGLD"
     gtgttcgtgg atgagtgtgt gggcctgcgg gattggggcg gtcatggaga cggtcggccg        60
     atcgtgctcc tgcatggcct gatgggccgg gggcgtacct ggcgcaggca gatcccgtgg       120
     ctgcgccggt acggccgggt gttcaccttc gatgcggagt tccaccgcgg cacgggactc       180
     ccggtgcccg gcggtgacgt ctccaccgag cgcttcgtcg ccgatgtggc ggagatcctt       240
     acggtgctgg accagggccc ggctgttctg gtcggccact cgatgggcgg gttgcacgcc       300
     tggtgcaccg ccgccgagta tcccgaactc gtcgatgcgc tggtcgtcga ggacatgtcg       360
     cccgagttca ccgggcagtc cacggacacc tgggccccgt ggttcgccag ctggccggat       420
     cgcttcgcga cgcaggggca gtgcgaggag ctcttcggcg cggtcgcagg gcgctacttc       480
     tacgaggcct tcgatgacgg agtgctgcac ggcgacctcg agaccttccg cgccatcgcc       540
     gatcactggg ggctgcgcga tcactgggac caatggcgcg cggtagcggt gccgaccctg       600
     ttgatcgagg cggagttctc cgtcgttccc tccggagtgg gggaccggat ggtgcgcgac       660
     tacgccgggc ccgacctgcg gtacgtgcgg ttcgacggtg ccggtcacct cgcccacgac       720
     gatgccccgg accgctaccg cggcgccgtc gaggccttcc tctccggcct ggactag          777
//

If you have problems or comments...

PBIL Back to PBIL home page