(data stored in ACNUC1104 zone)

EMBL: CP001966.PE577

CP001966.PE577       Location/Qualifiers
FT   CDS_pept        complement(617059..617904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0593"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; Male
FT                   sterility domain; KEGG: nfa:nfa10990 putative short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77231"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77231.1"
FT                   /translation="MTTPTYVVTGANGGLGQVVTRRLAATGGRVVMACRDIDGARRIAD
FT                   GIDGDITVGKLDLGDLDSVRAFADSVGDVDVLVNNAGLMNIPLKRTKQGFEMQFGVNHL
FT                   GHFLLTGLLLDRLTDRVVAVSSVAHRQNFRWRMDDPNYEHRKYLRSEAYGQSKLANMMF
FT                   ARELQRRFEAAGSDKRAYYVHPGVSPTGLFTRTETPLDRVARQAVALLSNPPEQAAEAL
FT                   VLAATDRDLDPHPWWGPSQLFQTRGKVGKCSTTAESKDKTKWAELWDVSERLTGFTYPV
FT                   "
     atgaccacac ctacctatgt tgtgaccggc gcgaacggcg gcctcggcca ggtcgtcacg        60
     cgccgcctcg ccgccacggg cggccgcgtt gtgatggcct gccgggacat cgacggcgcg       120
     cggcgcatcg ccgacggcat cgacggcgat atcaccgtcg ggaaactgga cctgggcgat       180
     ctcgactccg tgcgtgcctt cgccgattcc gttggcgatg tcgacgtgct ggtgaacaac       240
     gccggactga tgaacatccc gctcaagcgg acgaagcagg gcttcgagat gcagttcggg       300
     gtgaatcatc tggggcactt cctactcacc gggctcctgc tggaccgact caccgatcgg       360
     gtcgtggcgg tctcgtcggt ggcgcaccga cagaacttcc ggtggcggat ggacgacccg       420
     aactacgagc accgcaagta ccttcgcagc gaggcctacg gccagagcaa gctcgcgaac       480
     atgatgttcg cgcgcgagct gcaacgccgg ttcgaggcgg cgggttcgga caagcgggcc       540
     tactacgtgc accctggtgt gtcgccgacc ggtctgttca cccgcaccga gactccgctc       600
     gaccgggtcg cccggcaagc ggtcgcactg ctgtcgaacc cacccgagca ggctgcggag       660
     gccctcgtcc tggccgcgac cgaccgcgat ctcgatccgc acccgtggtg gggcccgagc       720
     cagctgttcc agacccgcgg caaggtgggc aagtgctcga ccaccgcgga gtcgaaggat       780
     aagaccaagt gggccgagct gtgggacgtc tcggagcggc tgacgggctt cacctacccg       840
     gtgtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page